DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4483 and ZDHHC18

DIOPT Version :9

Sequence 1:NP_648294.1 Gene:CG4483 / 39057 FlyBaseID:FBgn0035970 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_115659.1 Gene:ZDHHC18 / 84243 HGNCID:20712 Length:388 Species:Homo sapiens


Alignment Length:263 Identity:64/263 - (24%)
Similarity:108/263 - (41%) Gaps:55/263 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 GPITLLTLTLIVTWTVIHMNSMWWAPGSSLESVLNYALIWIQTFGTLYNFIRSLMV-----GPGF 75
            |.:..|||.||:|.|.:..  ::..|..:.:..|...:|    ...|:.|:.|.::     .||.
Human    91 GGVFALTLLLILTTTGLFF--VFDCPYLARKLTLAIPII----AAILFFFVMSCLLQTSFTDPGI 149

  Fly    76 VPLKW--------------------HPQLTKDKMF------LQFCTRCNGYKAPRSHHCRRCNRC 114
            :|...                    .|..|::.:.      |::|..|..::.||:.||..|:.|
Human   150 LPRATVCEAAALEKQIDNTGSSTYRPPPRTREVLINGQMVKLKYCFTCKMFRPPRTSHCSVCDNC 214

  Fly   115 VMKMDHHCPWINTCVGWSNQDSFVYFL--LFFMSGSIHGGIIIVSAVIRGIKKRWLIRYGLRHMA 177
            |.:.||||||:..|||..|...|..|:  |.|::.      .|.:.|:..:..|   ..|...::
Human   215 VERFDHHCPWVGNCVGRRNYRFFYAFILSLSFLTA------FIFACVVTHLTLR---AQGSNFLS 270

  Fly   178 TVHLTQTN---LLACVFSLGVIMGTVLASIKLLYMQMKSILKNQTEIENWIVKKAAFRR-NAYPR 238
            |:..|..:   |:.|.||:..|:|  |:... .|:...::..|:....:|..|:..... |.|..
Human   271 TLKETPASVLELVICFFSIWSILG--LSGFH-TYLVASNLTTNEDIKGSWSSKRGGEASVNPYSH 332

  Fly   239 KGI 241
            |.|
Human   333 KSI 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4483NP_648294.1 zf-DHHC 88..224 CDD:279823 39/146 (27%)
ZDHHC18NP_115659.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..67
zf-DHHC 191..314 CDD:279823 39/134 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 364..388
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.