DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4483 and AT4G22750

DIOPT Version :9

Sequence 1:NP_648294.1 Gene:CG4483 / 39057 FlyBaseID:FBgn0035970 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_567668.1 Gene:AT4G22750 / 828372 AraportID:AT4G22750 Length:302 Species:Arabidopsis thaliana


Alignment Length:298 Identity:82/298 - (27%)
Similarity:119/298 - (39%) Gaps:90/298 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 GPITLLTLTLIVTWTVIHMNSMWWAPG------SSLESVLNYALIWIQTFGTLYNFIRSLMVGPG 74
            |.|.:|.:..|:.:|...:..:.:.|.      .||.|||..|.........|:::...::..||
plant    16 GSIMILIVIGIIGFTYYAVVVVNYGPALLIGGVDSLLSVLVLAFFHFLLIMLLWSYFSVVVTDPG 80

  Fly    75 FVPLKWHPQLTKDKM------------------FLQFCTRCNGYKAPRSHHCRRCNRCVMKMDHH 121
            .||..|.|:|..:|.                  .:::|.:||.||.||||||..|.||::|||||
plant    81 GVPTGWRPELDIEKSEGNQALIGEASVGDSSSHGVRYCRKCNQYKPPRSHHCSVCGRCILKMDHH 145

  Fly   122 CPWINTCVGWSNQDSFV-------------------YFLLFFMSGSIHGGIIIVSAVIRGIKKRW 167
            |.|:..|||.:|..||:                   .||:||..|.   |.|.||          
plant   146 CVWVVNCVGANNYKSFLLFLFYTFLETTVVAVSLLPIFLVFFSDGD---GDITVS---------- 197

  Fly   168 LIRYGLRHMATVHLTQTNLLACVFSLGVI-MGTVLASIKLLYMQMKSILKNQTEIENWIVKKAAF 231
                            ...||..|...|: :...|:.:..|.|.:..:.:|.|.||         
plant   198 ----------------PGSLAASFVAFVLNIAFALSVLGFLIMHIMLVARNTTTIE--------- 237

  Fly   232 RRNAYPRKGIKPFVYPYNLGWKTNMREVFFSTGDGISW 269
               ||.:..:.   :|||:|.|||..:||.|  |.:.|
plant   238 ---AYEKHTVN---WPYNVGRKTNFEQVFGS--DKMYW 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4483NP_648294.1 zf-DHHC 88..224 CDD:279823 48/173 (28%)
AT4G22750NP_567668.1 zf-DHHC 111..241 CDD:279823 49/170 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1491968at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.