DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4483 and AT3G18620

DIOPT Version :9

Sequence 1:NP_648294.1 Gene:CG4483 / 39057 FlyBaseID:FBgn0035970 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_188492.2 Gene:AT3G18620 / 821393 AraportID:AT3G18620 Length:345 Species:Arabidopsis thaliana


Alignment Length:130 Identity:43/130 - (33%)
Similarity:67/130 - (51%) Gaps:10/130 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 FCTRCNGYKAPRSHHCRRCNRCVMKMDHHCPWINTCVGWSNQDSFVYFLLFFMSGSIHGGIIIVS 157
            ||..|:..|:||:||||.|..||:.||||||:|..|||..|...|:.||:..:..:.:..::.|.
plant   149 FCNYCSKPKSPRTHHCRTCGMCVLDMDHHCPFIGNCVGAGNHKYFIAFLISAVISTSYAAVMCVY 213

  Fly   158 AVIR---GIKKRWLIRYGLRHMATVHLTQTNLLACV--FSLGVIMGTVLASIK---LLYMQMKSI 214
            .:|.   .|:|.......:.|:|  |....::|..|  ..|..|...|..|::   |:|:.:.|:
plant   214 TLIHILPPIEKGAAYASDVAHVA--HGNSISILRVVKNICLTYIANAVFISVRSLVLVYLFVASV 276

  Fly   215  214
            plant   277  276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4483NP_648294.1 zf-DHHC 88..224 CDD:279823 43/130 (33%)
AT3G18620NP_188492.2 DHHC 76..>219 CDD:418707 29/69 (42%)
DHHC 149..298 CDD:396215 43/130 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22883
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.