DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4483 and AT3G09320

DIOPT Version :9

Sequence 1:NP_648294.1 Gene:CG4483 / 39057 FlyBaseID:FBgn0035970 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_566348.1 Gene:AT3G09320 / 820088 AraportID:AT3G09320 Length:286 Species:Arabidopsis thaliana


Alignment Length:283 Identity:73/283 - (25%)
Similarity:132/283 - (46%) Gaps:66/283 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 PITLLTLTL--IVTWTVIHMNSMWWAPGSSLESVLNYALIWIQTFGTLYNFIRSLMVGPGFVPLK 79
            |:|::.|.:  |...:|......|::..|| ..:.|.|.........:||:..::...||.|||.
plant    11 PVTVVMLVIGFIYFASVFTFIDRWFSLTSS-PGIANAAAFTALALMCIYNYSIAVFRDPGRVPLN 74

  Fly    80 WHP----------QLTKDKMFLQFCTRCNGYKAPRSHHCRRCNRCVMKMDHHCPWINTCVGWSNQ 134
            :.|          ::.:....|::|.:|:.:|.||:||||.|.|||::|||||.|||.|||.:|.
plant    75 YMPDVEDPESPVHEIKRKGGDLRYCQKCSHFKPPRAHHCRVCKRCVLRMDHHCIWINNCVGHTNY 139

  Fly   135 DSFVYFLLFFMSGSIHGGIIIVSAVI---------RGIKKRWLIRYGLRHMATVHLTQTNLLACV 190
            ..|..|:::.::..::..:::|.::.         .|           .::.|:::....||..:
plant   140 KVFFVFVVYAVTACVYSLVLLVGSLTVEPQDEEEEMG-----------SYLRTIYVISAFLLIPL 193

  Fly   191 -FSLGVIMGTVLASIKLLYMQMKSILKNQTEIE-------NWIVKKAAFRRNAYPRKGIKPFVYP 247
             .:|||::|.      .:|:    ||:|:|.||       .|:.:           ||.:.:.:|
plant   194 SIALGVLLGW------HIYL----ILQNKTTIEYHEGVRAMWLAE-----------KGGQVYKHP 237

  Fly   248 YNLGWKTNMREVFFSTGDGI-SW 269
            |::|...|:..:.   |..| ||
plant   238 YDIGAYENLTLIL---GPNILSW 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4483NP_648294.1 zf-DHHC 88..224 CDD:279823 44/152 (29%)
AT3G09320NP_566348.1 DHHC 94..217 CDD:396215 43/143 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1491968at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22883
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3745
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.880

Return to query results.
Submit another query.