DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4483 and Zdhhc4

DIOPT Version :9

Sequence 1:NP_648294.1 Gene:CG4483 / 39057 FlyBaseID:FBgn0035970 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_082655.1 Gene:Zdhhc4 / 72881 MGIID:1920131 Length:343 Species:Mus musculus


Alignment Length:295 Identity:75/295 - (25%)
Similarity:119/295 - (40%) Gaps:93/295 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 LESVLNYALI-WIQTFGTLYNFIRSLMVGPGFVPLKWHPQLTK-------------DKMFLQ--F 93
            ||..|.|.|: ::.....|..|..:....||        .:||             |.||.:  .
Mouse    94 LEFSLPYLLLPYVLLSVNLVFFTLTCAANPG--------TITKANESFLLQVYKFDDVMFPKNSR 150

  Fly    94 CTRCNGYKAPRSHHCRRCNRCVMKMDHHCPWINTCVG-WSNQDSFVYFLLFFMSGSIHGGIIIVS 157
            |..|:..|..||.|||.|:|||.:.||||.|:|.|:| |:.:    |||::.::      :...:
Mouse   151 CPTCDLRKPARSKHCRLCDRCVHRFDHHCVWVNNCIGAWNTR----YFLIYLLT------LTASA 205

  Fly   158 AVIRGIKKRWLIRY----------------GLRHMATVHLTQTNLLA---CVFSLG--VIMGTVL 201
            |.|..:...:|:|.                ..:.:.||.|.|...||   .||.||  :::..:|
Mouse   206 ATIATVTAAFLLRLVTVSDLYQETYLDDVGHFQAVDTVFLIQHLFLAFPRIVFLLGFVIVLSMLL 270

  Fly   202 ASIKLLYMQMKSILKNQTEIE----------NWIVKKAAFRRNAYPRKGIKPFVYPYNLGWKTNM 256
            |......:.:.:  .|||..|          .|.:  .|:..:|.||  |...::.:  |:::|:
Mouse   271 AGYLCFALYLAA--TNQTTNEWYKGDWAWCQRWPL--VAWSPSAEPR--IHQNIHSH--GFRSNL 327

  Fly   257 REVFFSTGDGISWPVLPDCNEYSLTCEQLQQKKDK 291
            ||:|           ||....|        :||:|
Mouse   328 REIF-----------LPATPSY--------KKKEK 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4483NP_648294.1 zf-DHHC 88..224 CDD:279823 46/169 (27%)
Zdhhc4NP_082655.1 DHHC 151..292 CDD:396215 44/152 (29%)
Di-lysine motif. /evidence=ECO:0000250|UniProtKB:Q9NPG8 340..343 2/2 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.