DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4483 and Zdhhc11

DIOPT Version :9

Sequence 1:NP_648294.1 Gene:CG4483 / 39057 FlyBaseID:FBgn0035970 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_081980.1 Gene:Zdhhc11 / 71164 MGIID:1918414 Length:347 Species:Mus musculus


Alignment Length:288 Identity:65/288 - (22%)
Similarity:107/288 - (37%) Gaps:87/288 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 WWAPGSSLESV--LNYALIWIQTFGTLYNFI-------RSLMVGPGFV-------------PLKW 80
            |..|..|.:::  :.|..:.|.|||....|:       .::::|..|:             |...
Mouse    37 WSPPLHSFQAISWITYLAMSIVTFGIFIPFLPYSWKYAANIVMGGVFIFHLIVHLIAITIDPADT 101

  Fly    81 HPQLTKD---------------KMFLQFCTRCNGYKAPRSHHCRRCNRCVMKMDHHCPWINTCVG 130
            :.:|.||               .:..|:|..|....:.::.||..||:||...||||.|:|.|||
Mouse   102 NVRLKKDYTQPVPAFDRSKHTHVIQNQYCHLCEVTASKKAKHCSACNKCVSGFDHHCKWLNNCVG 166

  Fly   131 WSNQDSFVYFLLFFMSGSIHGGIIIVSAVIRGI----------------------KKRWLIRYGL 173
            ..|     |:..|:...|...||:.|..::..|                      :..||:...|
Mouse   167 RRN-----YWFFFWSVASAAVGILGVMIILCYICIQYFVNPDELRTDPLYKEIISENTWLLFLSL 226

  Fly   174 -----RHMATVHLTQTNLLACVFSLGVIMGTVLASIKLLYMQMKSILKNQTEIENWIVKKAAFRR 233
                 :....:.:....||..:.|. |::|.:|  |..||:    |.||.:..:  .:.|..|::
Mouse   227 WPVPVKTPIVLSIAVMALLLAIASF-VMLGHLL--IFHLYL----ITKNMSTFD--YLMKTRFKK 282

  Fly   234 NAYP---------RKGIKPFVYPYNLGW 252
            |.:|         :||..|.....|..|
Mouse   283 NLHPAEEKELPLQKKGDLPQEKSDNWAW 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4483NP_648294.1 zf-DHHC 88..224 CDD:279823 41/162 (25%)
Zdhhc11NP_081980.1 zf-DHHC 123..277 CDD:279823 41/167 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 291..332 5/20 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.