DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4483 and Zdhhc1

DIOPT Version :9

Sequence 1:NP_648294.1 Gene:CG4483 / 39057 FlyBaseID:FBgn0035970 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_001365935.1 Gene:Zdhhc1 / 70796 MGIID:1918046 Length:484 Species:Mus musculus


Alignment Length:214 Identity:50/214 - (23%)
Similarity:79/214 - (36%) Gaps:62/214 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 HWGPITLLTL-TLIVTWTVIHMNSMWWAPGSSLESVLNYALIWIQTFGTLYNFIRSLMVGPGFVP 77
            ||.|.....: .:.....|:|:.::...|..:.....:|:       |.|..|.||         
Mouse    74 HWVPAGYACMGAIFAGHLVVHLTAVSIDPADANVRDKSYS-------GPLPIFNRS--------- 122

  Fly    78 LKWHPQLTKDKMFLQFCTRCNGYKAPRSHHCRRCNRCVMKMDHHCPWINTCVGWSNQDSFVYFLL 142
              .|..:.:|    ..|..|:...:.||.||..||:||...||||.|:|.|||..|      :.|
Mouse   123 --QHAHVIED----LHCNLCDVDVSARSKHCSACNKCVCGFDHHCKWLNNCVGERN------YRL 175

  Fly   143 FFMSGSIHGGIIIVSAVIRGIKKRWLIRYGLRHMATVHLTQTNLLACVFSLGVIMGTVLASIKLL 207
            |..|         |::.:.|:                      ||..:.:..|.:...:..::|.
Mouse   176 FLHS---------VASALLGV----------------------LLLVLVATYVFVEFFVNPMRLR 209

  Fly   208 YMQMKSILKNQTEIENWIV 226
            ..|...:|||.|::  |.|
Mouse   210 TNQHFEVLKNHTDV--WFV 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4483NP_648294.1 zf-DHHC 88..224 CDD:279823 34/135 (25%)
Zdhhc1NP_001365935.1 Mediates interaction with STING1. /evidence=ECO:0000250|UniProtKB:Q8WTX9 1..268 50/214 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..38
DHHC 126..281 CDD:396215 37/144 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 341..415
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 444..484
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.