DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4483 and Zdhhc24

DIOPT Version :9

Sequence 1:NP_648294.1 Gene:CG4483 / 39057 FlyBaseID:FBgn0035970 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_081752.2 Gene:Zdhhc24 / 70605 MGIID:1917855 Length:284 Species:Mus musculus


Alignment Length:300 Identity:71/300 - (23%)
Similarity:109/300 - (36%) Gaps:96/300 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 WGPITLLTLTLIVTWTVIHMNSMWWAPG----SSLESVLNYALIWIQTFGTLYN---FIRS---- 68
            |..:.:|.|..:          |...||    ..|...|..||...|....|.|   |:||    
Mouse    25 WAAVVVLELAYV----------MVLGPGPPPLGPLARALQLALAAYQLLNLLGNVVLFLRSDPSI 79

  Fly    69 ---LMVGPGFVPLKWHPQLTKDKMFLQFCTRCNGYKAPRSHHCRRCNRCVMKMDHHCPWINTCVG 130
               ::.|.| :...|           .:|.:|.....|||.||..|..|:::.||||..:..|||
Mouse    80 RGVMLAGRG-LGQGW-----------AYCYQCQSQVPPRSGHCSACRVCILRRDHHCRLLGCCVG 132

  Fly   131 WSNQDSFVYFLLFFMSGSIHGGIII---VSAVIRG---------IKKRWLI----RYGLRHMATV 179
            :.|...|:..||......:|..:::   :||:::.         :...||:    :..|...|..
Mouse   133 FHNYRPFLCLLLHSAGVLLHISVLLGPALSALLQAHSALYTVALLLLPWLMLLTGKVSLAQFALA 197

  Fly   180 HLTQTNLLACVFSLGVIMGTVLASIKLLYMQMKSILKNQTEIENWIVKKAAFRRNAYPRKGIKPF 244
            .:..|    ||      .|.:|....||:..| .:|:.||..| |             .:|    
Mouse   198 FVVDT----CV------AGALLCGAGLLFHGM-LLLRGQTTWE-W-------------ARG---- 233

  Fly   245 VYPYNLGWKTNMRE--------VFF-------STGDGISW 269
            .:.|:||...|::.        |:|       ..|||||:
Mouse   234 HHCYDLGTCHNLQAALGPRWALVWFWPFLASPLPGDGISF 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4483NP_648294.1 zf-DHHC 88..224 CDD:279823 39/151 (26%)
Zdhhc24NP_081752.2 zf-DHHC 95..232 CDD:279823 40/161 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.