DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4483 and Zdhhc2

DIOPT Version :9

Sequence 1:NP_648294.1 Gene:CG4483 / 39057 FlyBaseID:FBgn0035970 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_848482.1 Gene:Zdhhc2 / 70546 MGIID:1923452 Length:366 Species:Mus musculus


Alignment Length:320 Identity:76/320 - (23%)
Similarity:136/320 - (42%) Gaps:99/320 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 RRFIHWGPITLLTLTLIVTWT---------VIHMNSMWWAPGSSLESVLNYALIWIQTFGTLYNF 65
            ||.::|.|:..  ::|::.|:         ::.|.::    |..:..::.|.|::.....:.:..
Mouse    14 RRVLYWIPVVF--ISLLLGWSYYAYAIQLCIVSMENI----GEQVVCLMAYHLLFAMFVWSYWKT 72

  Fly    66 IRSLMVGPGFVPLKWHPQLTKDKMF------------------------------LQFCTRCNGY 100
            |.:|.:.|.   .::|....:.::.                              :::|.||...
Mouse    73 IFTLPMNPS---KEFHLSYAEKELLEREPRGEAHQEVLRRAAKDLPIYTRTMSGAIRYCDRCQLI 134

  Fly   101 KAPRSHHCRRCNRCVMKMDHHCPWINTCVGWSNQDSFVYFLLFFMSGSIHGGIIIVSAVIRGIKK 165
            |..|.|||..|::|::||||||||:|.|||:||...|:.||.:         .::....|.....
Mouse   135 KPDRCHHCSVCDKCILKMDHHCPWVNNCVGFSNYKFFLLFLAY---------SLLYCLFIAATDL 190

  Fly   166 RWLIRY---GLRH-MATVHLTQTNLLACVFSLGVIMGTVLASIKLLYMQMKSILKNQTEIENWIV 226
            ::.||:   ||.. .|..|:......|.:||:.      |:|:...:..:.|  ||::.:|    
Mouse   191 QYFIRFWTNGLPDTQAKFHIMFLFFAAAMFSVS------LSSLFGYHCWLVS--KNKSTLE---- 243

  Fly   227 KKAAFR----RNAYPRKGIKPFVYPYNLGWKTNMREVF-----------FST-GDGISWP 270
               |||    |:...:.|       ::||:..|||:||           ||: |||.|:|
Mouse   244 ---AFRNPVFRHGTDKNG-------FSLGFSKNMRQVFGDEKKYWLLPVFSSQGDGCSFP 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4483NP_648294.1 zf-DHHC 88..224 CDD:279823 43/169 (25%)
Zdhhc2NP_848482.1 DHHC 126..247 CDD:366691 45/144 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 296..366
Mediates localization to plasma membrane and recycling endosomes. /evidence=ECO:0000269|PubMed:21471008 298..366
Non-canonical dileucine endocytic signal. /evidence=ECO:0000269|PubMed:28768144 334..335
NPxY-like endocytic signal. /evidence=ECO:0000269|PubMed:28768144 357..360
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1491968at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.