DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4483 and Zdhhc21

DIOPT Version :9

Sequence 1:NP_648294.1 Gene:CG4483 / 39057 FlyBaseID:FBgn0035970 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_080923.2 Gene:Zdhhc21 / 68268 MGIID:1915518 Length:265 Species:Mus musculus


Alignment Length:232 Identity:65/232 - (28%)
Similarity:92/232 - (39%) Gaps:69/232 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 LYNFIRSLMVGPGFVPLKWHPQLT-KDKMFLQFCTRCNGYKAPRSHHCRRCNRCVMKMDHHCPWI 125
            |...:|:.:..||.:|  .:|::. .::...:.|.:||..:..|||||.||..||.:||||||||
Mouse    61 LVALVRASLTDPGRLP--ENPKIPHAERELWELCNKCNLMRPKRSHHCSRCGHCVRRMDHHCPWI 123

  Fly   126 NTCVGWSNQDSFV-----------YFLLF-------FMSGSIHGGIIIVSAVIRGIKKRWLIRYG 172
            |.|||..|...|:           |.|:|       |:.                :|||.|..:.
Mouse   124 NNCVGEDNHWLFLQLCFYTELLTCYALMFSFCHYYYFLP----------------LKKRNLDLFV 172

  Fly   173 LRHMATVHLTQTNLLACVFSLGVIMG-TVLASIK-LLYMQMKSILKNQTEIENWIVKKAAFRRNA 235
            :||.           ..:..|...|| |:|..|. |.|.|:..|:.:.|.||.   ........:
Mouse   173 VRHE-----------LAIMRLAAFMGITMLVGITGLFYTQLIGIITDTTSIEK---MSNCCEEIS 223

  Fly   236 YPRKGIKPFVYPYNLGWKTNMREVFFSTGDGISWPVL 272
            .|||           .|:....|||     |..|.:|
Mouse   224 RPRK-----------PWQQTFSEVF-----GTRWKIL 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4483NP_648294.1 zf-DHHC 88..224 CDD:279823 49/155 (32%)
Zdhhc21NP_080923.2 DHHC 92..217 CDD:396215 49/154 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.