DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4483 and Zdhhc16

DIOPT Version :9

Sequence 1:NP_648294.1 Gene:CG4483 / 39057 FlyBaseID:FBgn0035970 Length:435 Species:Drosophila melanogaster
Sequence 2:XP_006231465.1 Gene:Zdhhc16 / 654495 RGDID:1591893 Length:377 Species:Rattus norvegicus


Alignment Length:304 Identity:79/304 - (25%)
Similarity:119/304 - (39%) Gaps:84/304 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 IHWGPITLLTLTLIVTWTVI----------------------HMNSMWWAPGSSLESVLNYALIW 55
            |.|..:..:.|.:::|.:::                      |.....|          |..|| 
  Rat    76 IRWFGVVFVVLVIVLTGSIVAIAYLCVLPLILRTYSVPRLCWHFFYSHW----------NLILI- 129

  Fly    56 IQTFGTLYNFIRSLMVGPGFVPLKWHPQLTKDKMFLQFCTRCNGYKAPRSHHCRRCNRCVMKMDH 120
                  ::::.:::...||:     .||...|...:..|.:|...|..|:|||..|||||:||||
  Rat   130 ------VFHYYQAITTPPGY-----PPQGRNDIATVSICKKCIYPKPARTHHCSICNRCVLKMDH 183

  Fly   121 HCPWINTCVGWSNQDSFVYFLLFFMSGSI---HGGIIIVSAVIRGIKK-RWLIRYGLRHMA--TV 179
            ||||:|.|||..|...|..|..|...|.:   :|...:.......|:| :.|.:..|:.:|  |.
  Rat   184 HCPWLNNCVGHYNHRYFFSFCFFMTLGCVYCSYGSWDLFREAYAAIEKMKQLDKNKLQAIANQTY 248

  Fly   180 H------------LTQTNLLACVF---SLGVIMGTVLASIKLLYMQMKSILKNQTEIENWIVKKA 229
            |            :|..:|:...|   |:.:.:|.:.....:|      |.:.:|.||..|.||.
  Rat   249 HQTPPPTFSFRERITHKSLVYLWFLCSSVALALGALTMWHAVL------ISRGETSIERHINKKE 307

  Fly   230 AFRRNAYPRKGIKPFVYPYNLG----WKTNMREVFFSTGDGISW 269
            ..|..|   || :.|..|||.|    ||     ||.....|..|
  Rat   308 RRRLQA---KG-RVFRNPYNYGCLDNWK-----VFLGVDTGRHW 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4483NP_648294.1 zf-DHHC 88..224 CDD:279823 47/156 (30%)
Zdhhc16XP_006231465.1 DHHC 156..305 CDD:396215 48/154 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1491968at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.