DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4483 and ZDHHC6

DIOPT Version :9

Sequence 1:NP_648294.1 Gene:CG4483 / 39057 FlyBaseID:FBgn0035970 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_001338011.1 Gene:ZDHHC6 / 64429 HGNCID:19160 Length:413 Species:Homo sapiens


Alignment Length:421 Identity:163/421 - (38%)
Similarity:234/421 - (55%) Gaps:50/421 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 CIKLK----DDLRRFIHWGPITLLTLTLIVTWTVIHMNSMWWAPGSSLESVLNYALIWIQTFGTL 62
            |..:|    .:|:|..|||||..|.:..|.:...:..:.:|:.|..:....:|:.::...|...|
Human     5 CSVIKFENLQELKRLCHWGPIIALGVIAICSTMAMIDSVLWYWPLHTTGGSVNFIMLINWTVMIL 69

  Fly    63 YNFIRSLMVGPGFVPLKWHPQLTKDKMFLQFCTRCNGYKAPRSHHCRRCNRCVMKMDHHCPWINT 127
            ||:..::.||||||||.|.|::::|.|:||:|..|..||||||||||:||||||||||||||||.
Human    70 YNYFNAMFVGPGFVPLGWKPEISQDTMYLQYCKVCQAYKAPRSHHCRKCNRCVMKMDHHCPWINN 134

  Fly   128 CVGWSNQDSFVYFLLFFMSGSIHGGIIIVSAVIRGIKKR----W----------------LIRYG 172
            |.|:.|..||..|||....|.||...|.|..:...:..|    |                ::.:|
Human   135 CCGYQNHASFTLFLLLAPLGCIHAAFIFVMTMYTQLYHRLSFGWNTVKIDMSAARRDPLPIVPFG 199

  Fly   173 LRHMATVHLTQTNLLACVFSLGVIMGTVLASIKLLYMQMKSILKNQTEIENWIVKKAAFRRNAYP 237
            |...||.          :|:||:.:||.:|...|.::|||.||:|:|.||:||.:||..|...|.
Human   200 LAAFATT----------LFALGLALGTTIAVGMLFFIQMKIILRNKTSIESWIEEKAKDRIQYYQ 254

  Fly   238 RKGIKPFVYPYNLG--WKTNMREVF----FSTGDGISWPVLPDCNEYSLTCEQLQQKKDKRARTR 296
            ...:  ||:||::|  |: |.::||    ...|||:.|||...|::||||.|||:||.|||.|:.
Human   255 LDEV--FVFPYDMGSRWR-NFKQVFTWSGVPEGDGLEWPVREGCHQYSLTIEQLKQKADKRVRSV 316

  Fly   297 VFRCIRPATGHWVPIFSQGLWVSLQIPCTDDPRIALKPDDIIHVTRIQEYWLYGEIMISEKQKEK 361
            .::.|...:|...|: ::|:......|||::|||.|:..:.|..||...|||||:.::.:...|.
Human   317 RYKVIEDYSGACCPL-NKGIKTFFTSPCTEEPRIQLQKGEFILATRGLRYWLYGDKILDDSFIEG 380

  Fly   362 IRARKGAIRGWFPSCCAIEICEDSDSENDLA 392
            :    ..||||||..| :|.| ..|:|.|.|
Human   381 V----SRIRGWFPRKC-VEKC-PCDAETDQA 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4483NP_648294.1 zf-DHHC 88..224 CDD:279823 66/155 (43%)
ZDHHC6NP_001338011.1 DHHC 95..241 CDD:396215 66/155 (43%)
SH3 317..394 CDD:418401 27/82 (33%)
Di-lysine motif. /evidence=ECO:0000269|PubMed:21926431 410..413
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152419
Domainoid 1 1.000 139 1.000 Domainoid score I4798
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 303 1.000 Inparanoid score I2672
Isobase 1 0.950 - 0 Normalized mean entropy S2699
OMA 1 1.010 - - QHG52433
OrthoDB 1 1.010 - - D1491968at2759
OrthoFinder 1 1.000 - - FOG0006604
OrthoInspector 1 1.000 - - otm40981
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22883
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3745
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1413.820

Return to query results.
Submit another query.