DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4483 and ZDHHC7

DIOPT Version :9

Sequence 1:NP_648294.1 Gene:CG4483 / 39057 FlyBaseID:FBgn0035970 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_001139020.1 Gene:ZDHHC7 / 55625 HGNCID:18459 Length:345 Species:Homo sapiens


Alignment Length:225 Identity:65/225 - (28%)
Similarity:91/225 - (40%) Gaps:49/225 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 GSSLESVLNYALIWIQTFGTLYNFIRSLMVGPGFVPLKWHPQLTKDKMFLQFCTRCNGYKAPRSH 106
            |...|||.:..|..:........::.||.:.||.|..|              |.:|...|..|:|
Human   131 GEGTESVQSLLLGAVPKGNATKEYMESLQLKPGEVIYK--------------CPKCCCIKPERAH 181

  Fly   107 HCRRCNRCVMKMDHHCPWINTCVGWSNQDSFVYFLLFFMSGSIHGGIIIVSAVIRGIKKRWLIRY 171
            ||..|.||:.||||||||:|.|||..||..||.|.::....|:|..|:.....|..::.:|....
Human   182 HCSICKRCIRKMDHHCPWVNNCVGEKNQRFFVLFTMYIALSSVHALILCGFQFISCVRGQWTECS 246

  Fly   172 GLRHMATVHLTQTNLLACVFSL------GVIMGTVLASIKLLYMQMKSILKNQTEIENWIVKKAA 230
            ......||.|.   :..|:..|      .|:.||          |:.||..::||||....:|..
Human   247 DFSPPITVILL---IFLCLEGLLFFTFTAVMFGT----------QIHSICNDETEIERLKSEKPT 298

  Fly   231 FRRNAYPRKGIKPFVYPYNLGWKTNMREVF 260
            :.|               .|.|: .|:.||
Human   299 WER---------------RLRWE-GMKSVF 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4483NP_648294.1 zf-DHHC 88..224 CDD:279823 47/141 (33%)
ZDHHC7NP_001139020.1 zf-DHHC 168..295 CDD:307600 48/153 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1491968at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.