DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4483 and zdhhc20

DIOPT Version :9

Sequence 1:NP_648294.1 Gene:CG4483 / 39057 FlyBaseID:FBgn0035970 Length:435 Species:Drosophila melanogaster
Sequence 2:XP_017946765.1 Gene:zdhhc20 / 549883 XenbaseID:XB-GENE-958735 Length:375 Species:Xenopus tropicalis


Alignment Length:223 Identity:66/223 - (29%)
Similarity:100/223 - (44%) Gaps:56/223 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 LQFCTRCNGYKAPRSHHCRRCNRCVMKMDHHCPWINTCVGWSNQDSFVYFLLFFMSGSIHGGIII 155
            :::|.||...|..|.|||..|:.||:||||||||:|.|||:||   :.:||||.|...:: .:.|
 Frog   122 IRYCDRCQLIKPDRCHHCSTCDVCVLKMDHHCPWVNNCVGFSN---YKFFLLFLMYSLLY-CLFI 182

  Fly   156 VSAVIRGIKKRWLIRYGLRH-----------MATVHLTQTNLLACVFSLGVIMGTVLASIKLLYM 209
            .:.|::...|.|.:......           .|..|:.....:|.:|.:.:        :.|...
 Frog   183 AATVLQYFIKFWTLCRSKSEESCPQNELPDTRAKFHVLFLFFVAAMFFISI--------LSLFSY 239

  Fly   210 QMKSILKNQTEIENWIVKKAAFR----RNAYPRKGIKPFVYPYNLGWKTNMREV----------- 259
            ....:.||::.||       |||    ||...:.|       ::||:..|:|||           
 Frog   240 HCWLVGKNRSTIE-------AFRAPLFRNGPEKDG-------FSLGFSKNLREVFGDEKKYWLLP 290

  Fly   260 -FFSTGDGISWP---VLPDCNEYSLTCE 283
             |.|.|||.|:|   ||.|..:.:.|.:
 Frog   291 MFTSLGDGCSFPTRLVLGDPEQNAATVQ 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4483NP_648294.1 zf-DHHC 88..224 CDD:279823 43/143 (30%)
zdhhc20XP_017946765.1 DHHC 9..310 CDD:388695 64/213 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1491968at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.