DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4483 and zdhhc21

DIOPT Version :9

Sequence 1:NP_648294.1 Gene:CG4483 / 39057 FlyBaseID:FBgn0035970 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_001016073.1 Gene:zdhhc21 / 548827 XenbaseID:XB-GENE-855474 Length:264 Species:Xenopus tropicalis


Alignment Length:246 Identity:66/246 - (26%)
Similarity:103/246 - (41%) Gaps:63/246 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 ESVLNYALIWIQTFGTLY---NFIRSLMVGPGFVPLKWHPQL-TKDKMFLQFCTRCNGYKAPRSH 106
            |..::.|.||.....:::   :.:|:....||  .|:..|:: ..:|...:.|.:||..:..|||
 Frog    42 EGQISVAAIWAYYLTSIFCIISLLRASTADPG--KLQDSPKIPLTEKELWELCNKCNMMRPKRSH 104

  Fly   107 HCRRCNRCVMKMDHHCPWINTCVGWSNQDSFVYFLLFFMSGSIHGGIIIVS----------AVIR 161
            ||.||..||.:|||||||||.|||..|.  :::..|.|.:..:.|..:::.          |:  
 Frog   105 HCSRCGHCVRRMDHHCPWINNCVGEDNH--WLFLQLCFYTQLLSGYTLVLDFCHYYYFLPLAI-- 165

  Fly   162 GIKKRWLIRYGLRHMATVHLTQTNLLACVFSLGVIMGTVLASIKLLYMQMKSILKNQTEIENWI- 225
                .|.| :..||       :..||.....:|::|...:.|  |.|.|:..||.:.|.||... 
 Frog   166 ----NWDI-FIFRH-------ELALLRISTFMGIVMFGGMCS--LFYTQIMGILTDTTTIEKMAN 216

  Fly   226 ----VKKAAFRRNAYPRKGIKPFVYPYNLGWKTNMREVFFSTGDGISWPVL 272
                :.:|.           ||        |:....|||     |..|.:|
 Frog   217 CCDEISRAR-----------KP--------WQQTFSEVF-----GTRWKIL 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4483NP_648294.1 zf-DHHC 88..224 CDD:279823 47/145 (32%)
zdhhc21NP_001016073.1 DHHC 92..216 CDD:366691 46/141 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1491968at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.