DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4483 and zdhhc2

DIOPT Version :9

Sequence 1:NP_648294.1 Gene:CG4483 / 39057 FlyBaseID:FBgn0035970 Length:435 Species:Drosophila melanogaster
Sequence 2:XP_021336686.1 Gene:zdhhc2 / 541365 ZFINID:ZDB-GENE-050320-58 Length:374 Species:Danio rerio


Alignment Length:347 Identity:87/347 - (25%)
Similarity:139/347 - (40%) Gaps:113/347 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 DLRRFIHWGPITLLTLTLIVTW------------TVIHMNSMWWAPGSSLESVLNYALIWIQTFG 60
            |..|.::|.|:  |.::|||.|            |:.:|       |.....:|.|.|:::....
Zfish    10 DCWRVLYWIPV--LFISLIVAWSYYAYVVQLCIETIENM-------GEKTVYLLIYHLLFLMFVW 65

  Fly    61 TLYNFIRSLMVGPGFVPLK-WH----------------------PQLTKDKMF--------LQFC 94
            :.:..|.|..:.    ||| :|                      .::.||...        :::|
Zfish    66 SYWQTIYSKPMN----PLKEFHLSHVDKELLEREDRRESQQEILRRIAKDLPIYTRTMSGAIRYC 126

  Fly    95 TRCNGYKAPRSHHCRRCNRCVMKMDHHCPWINTCVGWSNQDSFVYFLLFFMSGSIHGGIIIVSAV 159
            .||...|..|.|||..|:.|::||||||||:|.|||::|...|:.||.:    |:...:.:.:..
Zfish   127 DRCLLLKPDRCHHCSACDMCILKMDHHCPWVNNCVGFANYKFFMLFLAY----SLLYCLFVTATD 187

  Fly   160 IRGIKKRW---------LIRY--GLRH-MATVHLTQTNLLACVFSLGVIMGTVLASIKLLYMQMK 212
            ::...:.|         ||:|  ||.. .|..|:......|..||:.:..        |......
Zfish   188 MQYFIQFWTVDGKTHDRLIQYLNGLPDTQAKFHIMFLFFAASTFSVSLAF--------LFAYHCW 244

  Fly   213 SILKNQTEIENWIVKKAAFRRNAY----PRKGIKPFVYPYNLGWKTNMREVF-----------FS 262
            .:.||::.:|       |||..|:    .:.|       ::||...|.|:||           ||
Zfish   245 LVCKNRSTLE-------AFRAPAFQHGTDKNG-------FSLGAYKNFRQVFGDEKKYWLLPIFS 295

  Fly   263 T-GDGISWP---VLPDCNEYSL 280
            : |||.|:|   |.||..:.|:
Zfish   296 SLGDGCSFPTCLVNPDPEQPSI 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4483NP_648294.1 zf-DHHC 88..224 CDD:279823 42/155 (27%)
zdhhc2XP_021336686.1 zf-DHHC 11..305 CDD:327686 81/332 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1491968at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.