DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4483 and ZDHHC2

DIOPT Version :9

Sequence 1:NP_648294.1 Gene:CG4483 / 39057 FlyBaseID:FBgn0035970 Length:435 Species:Drosophila melanogaster
Sequence 2:XP_011542846.1 Gene:ZDHHC2 / 51201 HGNCID:18469 Length:412 Species:Homo sapiens


Alignment Length:197 Identity:64/197 - (32%)
Similarity:100/197 - (50%) Gaps:45/197 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 LQFCTRCNGYKAPRSHHCRRCNRCVMKMDHHCPWINTCVGWSNQDSFVYFLLFFMSGSIHGGIII 155
            :::|.||...|..|.|||..|::|::||||||||:|.|||:||   :.:||| |::.|:...:.|
Human   171 IRYCDRCQLIKPDRCHHCSVCDKCILKMDHHCPWVNNCVGFSN---YKFFLL-FLAYSLLYCLFI 231

  Fly   156 VSAVIRGIKKRWLIRYGLRH-MATVHLTQTNLLACVFSLGVIMGTVLASIKLLYMQMKSILKNQT 219
            .:..::...|.|  ..||.. .|..|:......|.:||:.      |:|:...:..:.|  ||::
Human   232 AATDLQYFIKFW--TNGLPDTQAKFHIMFLFFAAAMFSVS------LSSLFGYHCWLVS--KNKS 286

  Fly   220 EIENWIVKKAAFR----RNAYPRKGIKPFVYPYNLGWKTNMREVF-----------FST-GDGIS 268
            .:|       |||    |:...:.|       ::||:..|||:||           ||: |||.|
Human   287 TLE-------AFRSPVFRHGTDKNG-------FSLGFSKNMRQVFGDEKKYWLLPIFSSLGDGCS 337

  Fly   269 WP 270
            :|
Human   338 FP 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4483NP_648294.1 zf-DHHC 88..224 CDD:279823 45/133 (34%)
ZDHHC2XP_011542846.1 zf-DHHC 172..293 CDD:279823 47/141 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1491968at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.