DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4483 and Zdhhc11

DIOPT Version :9

Sequence 1:NP_648294.1 Gene:CG4483 / 39057 FlyBaseID:FBgn0035970 Length:435 Species:Drosophila melanogaster
Sequence 2:XP_038942712.1 Gene:Zdhhc11 / 499000 RGDID:1564281 Length:364 Species:Rattus norvegicus


Alignment Length:315 Identity:66/315 - (20%)
Similarity:112/315 - (35%) Gaps:99/315 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 WWAPGSSLESV--LNYALIWIQTFG-------TLYNFIRSLMVGPGFV-------------PLKW 80
            |..|..|.:::  ..|..:.|.|||       |.:.:..:.::|..|:             |...
  Rat    37 WSPPLHSFQAISWTTYLAMSIVTFGIFIPFLPTSWKYAANAVMGGVFMFHLVVHLIAITIDPADT 101

  Fly    81 HPQLTKDKMFL-----------------QFCTRCNGYKAPRSHHCRRCNRCVMKMDHHCPWINTC 128
            :.:|.||  :|                 |:|..|....:.::.||..||:||...||||.|:|.|
  Rat   102 NVRLKKD--YLEPVPTFDRSKHAHVIQNQYCHLCEVTVSKKAKHCSSCNKCVSGFDHHCKWLNNC 164

  Fly   129 VGWSNQDSFVYFLLFFMSGSIHGGIIIVSAVIRGIKKRWLIRY-----GLRH------------- 175
            ||..|     |:..||...|...|::.|..::..|    .|:|     |||.             
  Rat   165 VGKRN-----YWFFFFSVASAAFGLLGVLIILLYI----FIQYFVNPNGLRMDPLYKGAAVWIGA 220

  Fly   176 -----MATVHLTQTNLLACVFSLG-------VIMGTVLASIKLLYMQMKSILKNQTEIENWIVKK 228
                 ...:.::..|......||.       |:: ::.|.:.||.:....:|.:......:::.|
  Rat   221 GWTCLSVFIEISSENTWLLFLSLSPVPVKTPVVL-SIAAMVLLLAIASFVLLGHLLVFHFYLISK 284

  Fly   229 ----------AAFRRNAYPRKGIKPFVYPYNLGWKTNMREVFFSTGDGISWPVLP 273
                      ..|:::  ||...|..:.|...|      .|.....:.::||..|
  Rat   285 KLSTFDYMMQTRFQKS--PRPAEKKELPPRKKG------NVSQEKSNNLTWPTSP 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4483NP_648294.1 zf-DHHC 88..224 CDD:279823 40/182 (22%)
Zdhhc11XP_038942712.1 DHHC 123..294 CDD:396215 40/180 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.