DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4483 and CG17197

DIOPT Version :9

Sequence 1:NP_648294.1 Gene:CG4483 / 39057 FlyBaseID:FBgn0035970 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_651425.2 Gene:CG17197 / 43111 FlyBaseID:FBgn0039367 Length:290 Species:Drosophila melanogaster


Alignment Length:252 Identity:56/252 - (22%)
Similarity:94/252 - (37%) Gaps:67/252 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 YALIWIQTFGTLYNFIRSLMVGPGFVPLKWH------PQLTKDKMFLQ--------FCTRCNGYK 101
            |.|.|:......||...::        |..|      ..|.||:...:        :|..|....
  Fly    58 YKLGWLVAIFITYNIFGNM--------LACHITSTSVESLPKDRQIPEPEEEHQWHYCDVCEKLM 114

  Fly   102 APRSHHCRRCNRCVMKMDHHCPWINTCVGWSNQDSFVYFLLFFMSGSIHGGIIIVSAVIRGIKKR 166
            .|||.||..|..|::|.|.||.:..:|||.:||..|.:|.||...|:   |:.:.:.:|..:|  
  Fly   115 PPRSWHCILCKCCILKRDRHCIFTASCVGHNNQRYFFWFTLFMALGT---GVALATHIIATLK-- 174

  Fly   167 WLIRYGLRHMATVHLTQTNLLACVFSLGVIMGTVL--ASIKLLYMQMKSILKNQTEIENWIVKKA 229
               .:....:..:::.:.||......:.:|:.|.:  |.:..:.||: |:|||...:.       
  Fly   175 ---YFSYSDLIFLNIPRDNLPPFWLVITLILNTYVFAAPVSSVLMQL-SVLKNNGTLH------- 228

  Fly   230 AFRRNAYPRKGIKPFVYPYNLGWKTNMREVFFSTG---------------DGISWPV 271
                        |.:...|:||...|.:.:....|               ||..|.:
  Fly   229 ------------KFYSDTYDLGLWENFKLILGGKGFWTFLSPTVKSPLPHDGAQWKI 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4483NP_648294.1 zf-DHHC 88..224 CDD:279823 37/145 (26%)
CG17197NP_651425.2 PHA02688 <9..70 CDD:222919 3/11 (27%)
zf-DHHC 100..>198 CDD:279823 28/105 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467515
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.