DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4483 and CG10344

DIOPT Version :9

Sequence 1:NP_648294.1 Gene:CG4483 / 39057 FlyBaseID:FBgn0035970 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_611671.1 Gene:CG10344 / 37565 FlyBaseID:FBgn0034729 Length:278 Species:Drosophila melanogaster


Alignment Length:276 Identity:58/276 - (21%)
Similarity:102/276 - (36%) Gaps:45/276 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 ITLLTLTLIVTWTVIHMNSMWWAPGSSLESVLNYALIWIQTFGTLYNFIRSLMVGPGFVPLKWHP 82
            |..:.|.::..:.::.:...:..||....: ..:.:.....|....|.|..:|:.......|..|
  Fly    20 IIAVFLPVVFMFEIVVVLPAFHEPGGFFHT-FTFLMAMFLVFNIKGNMIACMMIDTSVNVKKVEP 83

  Fly    83 QLTKDKMFLQFCTRCNGYKAPRSHHCRRCNRCVMKMDHHCPWINTCVGWSNQDSFVYFLLFFMSG 147
              ..|::..:.|..|.....|||.||:.|..|::|.||||.:...|:|..|...|:.|:.:...|
  Fly    84 --PSDQLNWRECGECQKLAPPRSWHCKACKVCILKRDHHCIYTGCCIGLRNHRFFMGFIFYLFVG 146

  Fly   148 SIHGGII--IVSAVIRG-IKKRWL----IRYGLRHMATVHLTQTNLLACVFSLGVIMGTVLASIK 205
            |::..:.  |...||.| |...|:    :...:.|:.|... .||:....:||.::  .:...:.
  Fly   147 SVYALVYNSIYMWVIHGHIYSNWVTVLKLACPMLHLVTGSF-WTNMYLVFYSLNIL--ALAYGVL 208

  Fly   206 LLYMQMKSILKNQTEIENWIVKKAAFRRNAYPRKGIKPFVYPYNLGWKTNMREVFFS-------- 262
            ||...:..:|:.....:.....|..:.|..|                 .|:|.||.:        
  Fly   209 LLAYHVPIVLRGGVSADRTKESKEKYDRGVY-----------------QNLRSVFGNRMHLAWLS 256

  Fly   263 -------TGDGISWPV 271
                   ..||..|.|
  Fly   257 PLIRSDLPEDGYHWNV 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4483NP_648294.1 zf-DHHC 88..224 CDD:279823 36/142 (25%)
CG10344NP_611671.1 zf-DHHC 93..220 CDD:279823 36/129 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467514
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.