DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4483 and CG17287

DIOPT Version :9

Sequence 1:NP_648294.1 Gene:CG4483 / 39057 FlyBaseID:FBgn0035970 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_611197.1 Gene:CG17287 / 36939 FlyBaseID:FBgn0034202 Length:338 Species:Drosophila melanogaster


Alignment Length:351 Identity:83/351 - (23%)
Similarity:140/351 - (39%) Gaps:109/351 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 IHWGPITLLTLTLIVTWTVIHMNSMWWAPGSSLESVLNYALI-------WIQTFGTLYNFIRSLM 70
            :.|.| .|:.|..:| |: .|:    :.....::.|.:|..|       .:..|..|:.:.|.:.
  Fly    16 VRWLP-ALIILGFLV-WS-YHV----FVYQICIKKVSDYLTIGLLLFFYHLLLFMFLWTWFRCIF 73

  Fly    71 VGPGFVPLKW--HPQLTKDKM-----------------------------FLQFCTRCNGYKAPR 104
            |.|..:|.:|  .|: ..||:                             .:::|..|...|..|
  Fly    74 VAPVRIPDQWKISPE-DVDKLKRNDGIEGASRVLNYAARNLPIATCTIDGLVRYCKTCWIIKPDR 137

  Fly   105 SHHCRRCNRCVMKMDHHCPWINTCVGWSNQDSFVYFLLFFMSGS----------IHGGIIIVSAV 159
            :||||.|:.||:|||||||||..||.:.|   |.||:||.....          ::...:|....
  Fly   138 AHHCRTCHMCVLKMDHHCPWIVNCVHFHN---FKYFILFLFYAEVYCFYLFCVMVYDLYLICGFE 199

  Fly   160 IRGIKKR--W-LIRYGLRHMATVHLTQTNLLACVFSLGVIMGTVLASIKLLYMQMKSILKNQTEI 221
            :..:|.:  | :::|               |.|:  |..|...::.::.||     ::.:|:|.:
  Fly   200 VTALKNQHSWNILQY---------------LVCI--LFNIFTVIMYTVSLL-----NVSRNRTTM 242

  Fly   222 ENWIVKKAAFRRNAYPRKGIKPFVYPYNLGWKTNMRE------------VFFSTGDGISWPVLPD 274
            |:  .....|........|       :|||:..|.|:            :|.|.|||.|:|:..|
  Fly   243 ES--AYATYFLLGGKNNNG-------FNLGYFVNFRDLYGDKWYLWPFPIFSSRGDGFSFPLAHD 298

  Fly   275 CNEYSLTCEQLQQKKDKR-ARTRVFR 299
            ..:...|.   .||||.: .||::::
  Fly   299 RLKEVRTG---NQKKDNQPTRTQMYK 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4483NP_648294.1 zf-DHHC 88..224 CDD:279823 42/177 (24%)
CG17287NP_611197.1 zf-DHHC 125..243 CDD:279823 40/142 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467473
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1491968at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22883
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.