DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4483 and CG8314

DIOPT Version :9

Sequence 1:NP_648294.1 Gene:CG4483 / 39057 FlyBaseID:FBgn0035970 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_611070.1 Gene:CG8314 / 36757 FlyBaseID:FBgn0034057 Length:293 Species:Drosophila melanogaster


Alignment Length:264 Identity:78/264 - (29%)
Similarity:120/264 - (45%) Gaps:39/264 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 LIVTWTVI------HMNSMWWAPGSSLESVLNYALIWIQTFGTLYNFIRSLMVGPGFVPLKWHPQ 83
            :|:||.:|      .|..:......::.|.:|..:.....|....:.||:::..||.||   ...
  Fly    42 VIMTWLLILFAEFVVMRLILLPSNYTVFSTINMIIFQALAFLAFASHIRTMLSDPGAVP---RGN 103

  Fly    84 LTKD----------KMFLQFCTRCNGYKAPRSHHCRRCNRCVMKMDHHCPWINTCVGWSNQDSFV 138
            .||:          :||.: |.:|...|..|:|||..|.||:.||||||||:|.|||.:||..||
  Fly   104 ATKEMIEQMGYREGQMFYK-CPKCCSIKPERAHHCSVCQRCIRKMDHHCPWVNNCVGENNQKYFV 167

  Fly   139 YFLLFFMSGSIHGGIIIVSAVIRGIKKRWLIRYGLRHMATVHLTQTNLLACVFSLGVIMGTVLAS 203
            .|..:..|.|:|...::::.....:|..|.........||:.|    ||...|. |::.|  :.:
  Fly   168 LFTFYIASISVHTLFLVLTQFAECVKNDWRTCSPYSPPATIFL----LLFLTFE-GLMFG--IFT 225

  Fly   204 IKLLYMQMKSILKNQTEIENWIVKKAAFRRNAYPR-KGIKPFVYPYNLGW---------KTNMRE 258
            |.:|..|:.:||.:||.||.  :||...|.....| |.|:.....::|.|         :|....
  Fly   226 IIMLATQLTAILNDQTGIEQ--LKKEEARWAKKSRLKSIQSVFGRFSLAWFSPFTEPSCRTRFNS 288

  Fly   259 VFFS 262
            .|:|
  Fly   289 HFYS 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4483NP_648294.1 zf-DHHC 88..224 CDD:279823 51/135 (38%)
CG8314NP_611070.1 DHHC 122..249 CDD:396215 50/136 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467503
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1491968at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm46724
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22883
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.