DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4483 and Zdhhc13

DIOPT Version :9

Sequence 1:NP_648294.1 Gene:CG4483 / 39057 FlyBaseID:FBgn0035970 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_001382044.1 Gene:Zdhhc13 / 365252 RGDID:1309736 Length:622 Species:Rattus norvegicus


Alignment Length:334 Identity:81/334 - (24%)
Similarity:123/334 - (36%) Gaps:104/334 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 ITLLTLT------------LIVTWTVIHMNSMWW------------APGSSLESVLNYALIW-IQ 57
            :.||.||            |:...||..::|::|            |.||.    ..:|.|: |.
  Rat   325 VALLFLTSLFPRFLVGYKNLVYLPTVFLLSSIFWIFMTWFILFFPDAAGSP----FYFAFIFSIM 385

  Fly    58 TFGTLYNFIRSLMVGPGFVPLKWHPQL--------TKDKMFLQFCTRCNGYKAPRSHHCRRCNRC 114
            .|  ||.|.::....|||.......:.        |....|..|||.|...|..||.||..||.|
  Rat   386 AF--LYFFYKTWATDPGFTKASEEERKVNIVTLAETGSLDFRTFCTSCLIRKPLRSLHCHVCNSC 448

  Fly   115 VMKMDHHCPWINTCVGWSNQDSFVYFLL---FFMSGSIHGGIIIVSAVIRGIKKRWLIRYGLRHM 176
            |.:.|.||.|...|:|:.|...:::|||   ......|:|..:                |...|.
  Rat   449 VARFDQHCFWTGRCIGFGNHHHYIFFLLSLSMVCDWIIYGSFV----------------YWSNHC 497

  Fly   177 AT--------VHLTQTNLLAC------VFSLGVI---MGTVL--------ASIKLLYMQMKSILK 216
            ||        .:|.|  ::||      :|.|...   ..|.|        |.:.|...:..|:||
  Rat   498 ATTFKEDGLWTYLNQ--IVACSPWVLYIFMLAAFHFSWSTFLLINQLFQIAFLGLTSHERISLLK 560

  Fly   217 NQTEIENWIVKKAAFRRNAYPRKGIKPFVYPYNLGWKTNMREVFFSTG-DGISWPVLPD-CNEYS 279
            ....::..:    :.|:.            |||||:..|:.: ||..| .|:..|.:.| .::|:
  Rat   561 QSRHMKQTL----SLRKT------------PYNLGFMQNLAD-FFQCGCFGLVKPCIIDWTSQYT 608

  Fly   280 LTCEQLQQK 288
            :.....::|
  Rat   609 MVFHPAKEK 617

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4483NP_648294.1 zf-DHHC 88..224 CDD:279823 43/163 (26%)
Zdhhc13NP_001382044.1 Ank_2 66..>269 CDD:423045
ANK repeat 81..112 CDD:293786
ANK repeat 114..146 CDD:293786
ANK repeat 148..179 CDD:293786
ANK repeat 181..247 CDD:293786
DHHC 423..557 CDD:396215 40/151 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.