DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4483 and CG1407

DIOPT Version :9

Sequence 1:NP_648294.1 Gene:CG4483 / 39057 FlyBaseID:FBgn0035970 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_001286264.1 Gene:CG1407 / 36043 FlyBaseID:FBgn0033474 Length:452 Species:Drosophila melanogaster


Alignment Length:483 Identity:106/483 - (21%)
Similarity:172/483 - (35%) Gaps:156/483 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 DDLRR----------FIHWGPITLLTLTLIVTWT----VIHM---NSMWWAPGSSLESVLN--YA 52
            ||.||          ...|.|:  |.:|.::.|:    |:.:   ||         |:.:.  :.
  Fly     4 DDHRRRKTPCGFCMAVFKWIPV--LFITAVIAWSYYAYVVELCIRNS---------ENRIGMIFM 57

  Fly    53 LIWIQTFGTLY--NFIRSLMVGPGFVPLKWH-PQLTKDKMF------------------------ 90
            |::...|.||:  ::.|::|...|.:|.:|. |.....::|                        
  Fly    58 LLFYHLFLTLFMWSYWRTIMTSVGRIPDQWRIPDEEVSRLFRADSPDTQKRILNNFARDLPVTNR 122

  Fly    91 -----LQFCTRCNGYKAPRSHHCRRCNRCVMKMDHHCPWINTCVGWSNQDSFVYFL-------LF 143
                 ::||.:|...|..|:|||..|:.||:||||||||:|.||.:.|...||.||       |:
  Fly   123 TMNGSVRFCEKCKIIKPDRAHHCSVCSCCVLKMDHHCPWVNNCVNFYNYKYFVLFLGYALVYCLY 187

  Fly   144 FMSGSIHGGIIIVSAVIRGIKKRWLI------------RYGLRHMATVHLTQTNLLACVFSLGVI 196
            ....|:|..:           :.|.:            :.....|...|:.....:|.:|::.: 
  Fly   188 VAFTSLHDFV-----------EFWKVGAYDNNGYSAQGQLNASGMGRFHILFLFFIAIMFAISL- 240

  Fly   197 MGTVLASIKLLYMQMKSILKNQTEIENWIVKKAAFRRNAYPRKGIKPFVYPYNLGWKTNMREVF- 260
                   :.|....:..:|.|:|.:|::  :...||.....:.|       ||||...|..||| 
  Fly   241 -------VSLFGYHIYLVLVNRTTLESF--RAPIFRVGGPDKNG-------YNLGRYANFCEVFG 289

  Fly   261 ----------FST-GDGISWPVLPDCNEYSLTCEQLQQKKDKRARTRVFRCIRPATGHWVPIFSQ 314
                      ||: |||.|:|...|.:..|.:..  .|:.|....|...|.....|         
  Fly   290 DDWQYWFLPVFSSRGDGYSYPTSSDQSRVSTSSP--TQRYDAMGDTTTSRLDGNPT--------- 343

  Fly   315 GLWVSLQIPCTDDPRIALKPDDIIHVTRIQEYWLYGEIMISEKQKEKIRARKGAIRGWFPSCCAI 379
                        |..|...|.|..:....|.........:...|..:|:.         ||.|..
  Fly   344 ------------DKLIGASPLDTTNHHHNQSPHQVRSTSVLPTQLLQIQP---------PSTCRD 387

  Fly   380 EICEDSDSENDLAGGEPVKEQDTAAIES 407
            |:   ::.:..||.|:.:.....||:.|
  Fly   388 EL---NERQQKLANGQSLDCSTPAAMSS 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4483NP_648294.1 zf-DHHC 88..224 CDD:279823 41/183 (22%)
CG1407NP_001286264.1 zf-DHHC 129..259 CDD:279823 39/148 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467471
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1491968at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22883
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.