DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4483 and Dnz1

DIOPT Version :9

Sequence 1:NP_648294.1 Gene:CG4483 / 39057 FlyBaseID:FBgn0035970 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_477449.1 Gene:Dnz1 / 34503 FlyBaseID:FBgn0027453 Length:276 Species:Drosophila melanogaster


Alignment Length:253 Identity:66/253 - (26%)
Similarity:106/253 - (41%) Gaps:87/253 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 LIVTWTVIHMNSMWWAPGSSLESVLNYALIWIQTFGTLYNFI---------RSLMVGPGFVPL-- 78
            :::.|.:  :.:|   |||          :|:.....|:|.:         :::...||.|||  
  Fly    26 VVIRWII--LTTM---PGS----------LWMSFHVVLFNTVVFLLAMSHSKAVFSDPGTVPLPA 75

  Fly    79 ------------------------KWHPQLTKDKMFLQFCTRCNGYKAPRSHHCRRCNRCVMKMD 119
                                    :|           ..||||..|:.||:||||.|.||:.:||
  Fly    76 NRLDFSDLHTTNKNNPPPGNGHSSEW-----------TVCTRCETYRPPRAHHCRICKRCIRRMD 129

  Fly   120 HHCPWINTCVGWSNQDSFVYFLLFFMSGSIHGGIIIVSAVIRGIKKRW--------LIRYGLRHM 176
            |||||||.|||..||..|:.||::....|::...:||.:.:      |        :|...||  
  Fly   130 HHCPWINNCVGERNQKYFLQFLIYVALLSLYSIALIVGSWV------WPCEECSQNVIETQLR-- 186

  Fly   177 ATVHLTQTNLLACVFSLGVIMGTVLASIKLLYMQMKSILKNQTEIENWIVKKAAFRRN 234
             .:|.....|::.:|.|.|        ..::..|:.:||.::|.:|. |.:|..:|.|
  Fly   187 -MIHSVILMLVSALFGLFV--------TAIMVDQLHAILYDETAVEA-IQQKGTYRPN 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4483NP_648294.1 zf-DHHC 88..224 CDD:279823 48/143 (34%)
Dnz1NP_477449.1 DHHC 97..228 CDD:396215 50/159 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467527
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1491968at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22883
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.