DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4483 and pfa5

DIOPT Version :9

Sequence 1:NP_648294.1 Gene:CG4483 / 39057 FlyBaseID:FBgn0035970 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_001018794.2 Gene:pfa5 / 3361262 PomBaseID:SPBC691.01 Length:312 Species:Schizosaccharomyces pombe


Alignment Length:238 Identity:58/238 - (24%)
Similarity:89/238 - (37%) Gaps:68/238 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 TFGTLYNFIRSL-MVGPGFVPLKWHPQLTKDKMFLQFCTRCNGYKAPRSHHCRRCNRCVMKMDHH 121
            |..|.|.|...: :.||...|              :.|..|..:...||||.|...||:.|.||:
pombe    92 TLYTYYGFDNPIFLCGPNGAP--------------RMCGTCKCWLPDRSHHSRVSMRCIRKFDHY 142

  Fly   122 CPWINTCVGWSNQDSFVYFLLFFMSGSIHGGIIIVSAVIRGIKKRWLIRYGLRHMATVHLTQTNL 186
            |.::...|.:|||..|..||.:..|.:.   ::::|..|. |.:.:..|         .|..|.:
pombe   143 CSFVGKDVCFSNQKFFYQFLFYGFSAAC---MVLISTAIM-ISRTYHYR---------SLPGTWI 194

  Fly   187 LACVFS------LGVIM----GTVLASIKLLYMQMKSILKNQTEIENWIVKKAAF---------- 231
            ...|||      |||::    |.:|.:|            |..|.:||..:..:|          
pombe   195 FVLVFSAFGVLFLGVMLVRHTGYLLLNI------------NSHEAKNWKTRIYSFSVFFPEHMDS 247

  Fly   232 RRNAYPRKGIKPFVYPYNLGWKTNMREVFF--------STGDG 266
            |.......|..|:...|:..|:..|.:.::        |.|||
pombe   248 RVLVQSDPGDLPWDRGYSENWRAVMGDHWYNWILPLRRSPGDG 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4483NP_648294.1 zf-DHHC 88..224 CDD:279823 38/145 (26%)
pfa5NP_001018794.2 COG5273 9..283 CDD:227598 54/229 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.