DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4483 and CG17075

DIOPT Version :9

Sequence 1:NP_648294.1 Gene:CG4483 / 39057 FlyBaseID:FBgn0035970 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_001245821.1 Gene:CG17075 / 33191 FlyBaseID:FBgn0031239 Length:968 Species:Drosophila melanogaster


Alignment Length:189 Identity:49/189 - (25%)
Similarity:85/189 - (44%) Gaps:37/189 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 CTRCN-GYKAPRSHHCRRCNRCVMKMDHHCPWINTCVGWSNQDSFVYFLLFFMSGSIHGGIIIVS 157
            |..|| ...:.|:.||..||:||.|.||||.|:|.|:|..|   :|.||:..:| ::...::||:
  Fly   199 CHLCNIRTSSNRTKHCSVCNKCVGKFDHHCKWLNHCIGSRN---YVAFLMCVVS-AVVATLVIVA 259

  Fly   158 AVIRG-----IKKRWLIRYGLRHMATVHLTQTNLLACVFSLGVIMGTVL-----ASIKLLYMQM- 211
            ||:..     |:..||..|.....::..:...:.:....||.  .||::     .|.:.::.:| 
  Fly   260 AVVAQIVFYYIQPDWLSFYWCPTESSHTIESGDFINITLSLS--NGTMMLIEQHTSEEDVHQEMW 322

  Fly   212 ------KSILKNQTEIENW--IVKKAAFRRNAYPRK-----------GIKPFVYPYNLG 251
                  .:|....|.:||:  |::.:|.|....|..           |:...::.:.||
  Fly   323 DEEQANMTISTLPTLLENFTAIIEASATRPGISPTNHTETQPVVTGIGLNETIFMFLLG 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4483NP_648294.1 zf-DHHC 88..224 CDD:279823 41/147 (28%)
CG17075NP_001245821.1 zf-DHHC 199..>282 CDD:279823 32/86 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.