DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4483 and Zdhhc8

DIOPT Version :9

Sequence 1:NP_648294.1 Gene:CG4483 / 39057 FlyBaseID:FBgn0035970 Length:435 Species:Drosophila melanogaster
Sequence 2:XP_006248672.1 Gene:Zdhhc8 / 303796 RGDID:1308875 Length:775 Species:Rattus norvegicus


Alignment Length:230 Identity:62/230 - (26%)
Similarity:89/230 - (38%) Gaps:56/230 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 LYNFIRSLMVGPGFVPLKWHPQLTKD---------------KMFLQFCTRCNGYKAPRSHHCRRC 111
            |.||..:..:.||..|.....:..:|               ::.:::|..|:.|:.||..||..|
  Rat    59 LANFSMATFMDPGVFPRADEDEDKEDDFRAPLYKNVDVRGIQVRMKWCATCHFYRPPRCSHCSVC 123

  Fly   112 NRCVMKMDHHCPWINTCVGWSNQDSFVYFLLFFMSGSIHGGIIIVSAVIRGIKKRWLIRYGLRH- 175
            :.||...||||||:|.|:|..|   :.||.||.:|.|.|    :|..|..|      :.|.|.| 
  Rat   124 DNCVEDFDHHCPWVNNCIGRRN---YRYFFLFLLSLSAH----MVGVVAFG------LLYVLNHS 175

  Fly   176 --MATVHLTQTNLLACVFSLGVIMGTVLASIKLLYMQMKSILKNQTEIENWIVKKAAFRRNAYPR 238
              :...|.|.|..:.||..|..|     ..|.|....:..:.:.:|..|....|.         |
  Rat   176 EGLGAAHTTITMAVMCVAGLFFI-----PVIGLTGFHVVLVTRGRTTNEQVTGKF---------R 226

  Fly   239 KGIKPFVYPYNLGWKTNMREVFFSTGDGISWPVLP 273
            .|:.||    ..|...|:..|..|       |:.|
  Rat   227 GGVNPF----TRGCYGNVEHVLCS-------PLAP 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4483NP_648294.1 zf-DHHC 88..224 CDD:279823 44/138 (32%)
Zdhhc8XP_006248672.1 zf-DHHC 99..224 CDD:279823 44/142 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.