DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4483 and Zdhhc3

DIOPT Version :9

Sequence 1:NP_648294.1 Gene:CG4483 / 39057 FlyBaseID:FBgn0035970 Length:435 Species:Drosophila melanogaster
Sequence 2:XP_038937239.1 Gene:Zdhhc3 / 301081 RGDID:1309041 Length:350 Species:Rattus norvegicus


Alignment Length:292 Identity:74/292 - (25%)
Similarity:119/292 - (40%) Gaps:90/292 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 SVLNYALIWIQTFGTLYNFIRSLMVGPGFVPLKWHPQLTKDKMFLQF-----------CTRCNGY 100
            |::|..:..:..|..|.:..|:::..||.||   ....||:  |::.           |.:|...
  Rat    76 SIINGIVFNLLAFLALASHCRAMLTDPGAVP---KGNATKE--FIESLQLKPGQVVYKCPKCCSI 135

  Fly   101 KAPRSHHCRRCNRCVMKMDHHCPWINTCVGWSNQDSFVYFLLFFMSGSIHGGIIIVSAVIRGIKK 165
            |..|:|||..|.||:.||||||||:|.|||.:||..||.|.::....|:|..|::....:...::
  Rat   136 KPDRAHHCSVCKRCIRKMDHHCPWVNNCVGENNQKYFVLFTMYIALISLHALIMVGFHFLHCFEE 200

  Fly   166 RWLIRYGLRHMATVHLTQTNLLACVFSL------GVIMGTVLASIKLLYMQMKSILKNQTEIENW 224
            .|..........||.|.   :|.|..:|      .|:.||          |:.||..::|.||. 
  Rat   201 DWTKCSSFSPPTTVILL---ILLCFEALLFLIFTSVMFGT----------QVHSICTDETGIER- 251

  Fly   225 IVKKAAFRRNAYPRKGIKPFVYPYNLGWKTNMREVF---FSTGDGISWPVLPDCNEYSLTCE--- 283
                  .:|:..||:        .:..|| :::|.|   ||    ::|     .|.::..|:   
  Rat   252 ------LQRSKQPRE--------QSGSWK-SVQEAFGGEFS----LNW-----FNPFTRPCQPEI 292

  Fly   284 ------------------------QLQQKKDK 291
                                    ||::.||:
  Rat   293 PIDKGLVRQVSSLSNMDNVETAEGQLEETKDR 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4483NP_648294.1 zf-DHHC 88..224 CDD:279823 47/152 (31%)
Zdhhc3XP_038937239.1 DHHC 128..253 CDD:396215 46/144 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1491968at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.