DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4483 and Zdhhc25

DIOPT Version :9

Sequence 1:NP_648294.1 Gene:CG4483 / 39057 FlyBaseID:FBgn0035970 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_001034422.1 Gene:Zdhhc25 / 300323 RGDID:1598341 Length:279 Species:Rattus norvegicus


Alignment Length:221 Identity:66/221 - (29%)
Similarity:100/221 - (45%) Gaps:39/221 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 PITLLTLTLIVTWTVIHMNSMW------WAPGSS-LESVLNYALIWIQTFGTLYNFIRSLMVGPG 74
            ||.:  |..:.||.:: ::..|      ..|.:: |..|.|..:..:.....|.:.:|:::..||
  Rat    34 PIGI--LCAMATWALV-LSGGWVLVRDLLIPSNNMLYIVANGMIFHLLASLALVSHLRTMLTDPG 95

  Fly    75 FVPLKWHPQLTKDKMFLQFCTRCNGYKAPRSHHCRRCNRCVMKMDHHCPWINTCVGWSNQDSFVY 139
            .|||...|    ....:.:|..|......|:.||..|.||:.|.||||||:|.|||..||.   |
  Rat    96 SVPLGNRP----GPDTVSYCPDCRSAIPKRAAHCAVCKRCIRKNDHHCPWVNNCVGEDNQK---Y 153

  Fly   140 FLLFFMSGSIHG-------GIIIVSAVIRGIKKRWLIRYGLRHMATVHLTQTNLLACVFSLGV-I 196
            ||||.|...:.|       ||.::.:..||   .|.....:...|.:          :|.|.| :
  Rat   154 FLLFIMYIGLSGTHVLLLLGIPVLCSYARG---EWDSSSSVSPPAPI----------LFLLLVAL 205

  Fly   197 MGTVLASIKLLYMQMKSILKNQTEIE 222
            ||.||:|: :|..||.:|..::|..|
  Rat   206 MGFVLSSV-MLCTQMCTIYTDKTTTE 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4483NP_648294.1 zf-DHHC 88..224 CDD:279823 48/143 (34%)
Zdhhc25NP_001034422.1 zf-DHHC 109..230 CDD:279823 47/137 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1491968at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.