DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4483 and ZDHHC8

DIOPT Version :9

Sequence 1:NP_648294.1 Gene:CG4483 / 39057 FlyBaseID:FBgn0035970 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_001171953.1 Gene:ZDHHC8 / 29801 HGNCID:18474 Length:778 Species:Homo sapiens


Alignment Length:247 Identity:63/247 - (25%)
Similarity:99/247 - (40%) Gaps:49/247 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 PITLLTLTLIVTWTVIHMNSMWWAPGSSLESVLNY-ALIWIQTFGTLYNFIRSLMVGPGFVPLKW 80
            |:......|:.:.|:..:.:..|...:...:|..| .:|::   ..|.||..:..:.||..|...
Human    16 PVATAAALLVGSSTLFFVFTCPWLTRAVSPAVPVYNGIIFL---FVLANFSMATFMDPGVFPRAD 77

  Fly    81 HPQLTKD---------------KMFLQFCTRCNGYKAPRSHHCRRCNRCVMKMDHHCPWINTCVG 130
            ..:..:|               ::.:::|..|:.|:.||..||..|:.||...||||||:|.|:|
Human    78 EDEDKEDDFRAPLYKNVDVRGIQVRMKWCATCHFYRPPRCSHCSVCDNCVEDFDHHCPWVNNCIG 142

  Fly   131 WSNQDSFVYFLLFFMSGSIHGGIIIVSAVIRGIKKRWLIRYGLRH---MATVHLTQTNLLACVFS 192
            ..|   :.||.||.:|.|.|    :|..|..|:.      |.|.|   :...|.|.|..:.||..
Human   143 RRN---YRYFFLFLLSLSAH----MVGVVAFGLV------YVLNHAEGLGAAHTTITMAVMCVAG 194

  Fly   193 LGVIMGTVLASIKLLYMQMKSILKNQTEIENWIVKKAAFRRNAYPRKGIKPF 244
            |..|     ..|.|....:..:.:.:|..|....|.         |.|:.||
Human   195 LFFI-----PVIGLTGFHVVLVTRGRTTNEQVTGKF---------RGGVNPF 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4483NP_648294.1 zf-DHHC 88..224 CDD:279823 44/138 (32%)
ZDHHC8NP_001171953.1 DHHC 99..224 CDD:366691 44/142 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 293..352
PHA03247 <333..771 CDD:223021
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 509..540
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.