DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4483 and Zdhhc1

DIOPT Version :9

Sequence 1:NP_648294.1 Gene:CG4483 / 39057 FlyBaseID:FBgn0035970 Length:435 Species:Drosophila melanogaster
Sequence 2:XP_008770707.1 Gene:Zdhhc1 / 291967 RGDID:1589775 Length:502 Species:Rattus norvegicus


Alignment Length:462 Identity:100/462 - (21%)
Similarity:154/462 - (33%) Gaps:157/462 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 HWGPITLLTL-TLIVTWTVIHMNSMWWAPGSSLESVLNYALIWIQTFGTLYNFIRSLMVGPGFVP 77
            ||.|.....: .:.....|:|:.::...|..:.....:|:       |.|..|.||         
  Rat    74 HWVPAGYACMGAIFAGHLVVHLTAVSIDPADANVRDKSYS-------GPLPIFNRS--------- 122

  Fly    78 LKWHPQLTKDKMFLQFCTRCNGYKAPRSHHCRRCNRCVMKMDHHCPWINTCVGWSNQDSFVYFLL 142
              .|..:.:|    ..|..|:...:.||.||..||:||...||||.|:|.|||..|      :.|
  Rat   123 --QHAHVIED----LHCNLCDVDVSARSKHCSACNKCVCGFDHHCKWLNNCVGERN------YRL 175

  Fly   143 FFMSGSIHGGIIIVSAVIRGIKKRWLIRYGLRHMATVHLTQTNLLACVFSLGVIMGTVLASIKLL 207
            |..|         |::.:.|:                      ||..:.:..|.:...:..::|.
  Rat   176 FLHS---------VASALLGV----------------------LLLVLVATYVFVEFFVNPMRLR 209

  Fly   208 YMQMKSILKNQTEIENWIVKKAAFRRNAYPRKGIKPFVYPYN-----LGWKTNMREVFFSTG--- 264
            ..|...:|||.|::  |.|...     |.|.:...|.:....     ||        ..||.   
  Rat   210 TNQHFEVLKNHTDV--WFVFLP-----AAPVETQAPAILALAALLILLG--------LLSTALLG 259

  Fly   265 ------DGISWPVLPDCNEYSLTCEQLQQKKD---------KRART--------RVFRCIRP-AT 305
                  ..:.|..| ...||.:.....|:.|:         ::.|:        |.|..:|| .:
  Rat   260 HLLCFHIYLMWHKL-TTYEYIVQHRPAQEAKETHKELESCPRKMRSIQEMEFYMRTFSHVRPEPS 323

  Fly   306 GHWVP----------IFSQGLWVSLQIPCTDDPRIALKPDDIIHVTRIQEYW---LYGEIMISEK 357
            |...|          :.:|| .|...:|.:.| .:||.|       |||..|   ....:.:|.:
  Rat   324 GQARPAALNANPSQFLATQG-QVEPPLPSSSD-TLALPP-------RIQPQWGLETQATLPLSLQ 379

  Fly   358 QKEKIRA----RKGAI----------------RGWFPSCCAIEICEDSDSENDLAGGEPVKEQDT 402
            :|.|.|.    |.|.:                |...||       .||.|.:....|..|....:
  Rat   380 EKRKRRVYRLPRSGTMDRELRLPKLRDTGTPSRHASPS-------SDSTSASPAHAGCSVDAYSS 437

  Fly   403 AAIESVE 409
            |:.||:|
  Rat   438 ASAESME 444

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4483NP_648294.1 zf-DHHC 88..224 CDD:279823 34/135 (25%)
Zdhhc1XP_008770707.1 DHHC 126..281 CDD:396215 48/211 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.