DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4483 and Zdhhc19

DIOPT Version :9

Sequence 1:NP_648294.1 Gene:CG4483 / 39057 FlyBaseID:FBgn0035970 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_001034348.1 Gene:Zdhhc19 / 288045 RGDID:1309014 Length:359 Species:Rattus norvegicus


Alignment Length:302 Identity:64/302 - (21%)
Similarity:109/302 - (36%) Gaps:98/302 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 WWAPGSSLESVLNYALI-------------WIQTFG--------------TLYNFIRSLMVGPGF 75
            |:.|  ||.:..|.:|:             |:...|              |.::.:......||.
  Rat    27 WFFP--SLFAAFNVSLLVFLSGLFFGFPCRWLVQNGEWVFPAVTGPLFILTFFSLVSLNFSDPGI 89

  Fly    76 V--------PLKWHPQLTKDKMF-LQFCTRCNGYKAPRSHHCRRCNRCVMKMDHHCPWINTCVGW 131
            :        |...|......:.| |::|.:|..::.||::||..||.||...||||.|:|.|:|.
  Rat    90 LHRGSVSEDPRTVHVVRVNQRAFRLEWCPKCLFHRPPRTYHCPWCNICVEDFDHHCKWVNNCIGH 154

  Fly   132 SNQDSFVYFLLFFMSGSIHGGIIIVSAVIRGIKKRWLIRYGLRHMATVHLTQTNLLACVFSLGVI 196
            .|...||..:||.   .::.|.::|:.::      :||.       |.||.        |||...
  Rat   155 RNFRLFVLLILFL---CLYSGALLVTCLM------FLIH-------TSHLP--------FSLDKA 195

  Fly   197 M---------GTVLASIKLLYMQMKSILKNQTEIENWIVKKAAFRRNAYPRKGIKPFVYPYNLGW 252
            |         |.::....|:.:|..|:.:.:...|:          .....:...||...:...|
  Rat   196 MAILVAVPAAGFLIPLFLLMLIQALSVSRAERSYES----------KCRDHEEYNPFDQGFAKNW 250

  Fly   253 KTNMREVFFSTGDGISWPVLPD------CNEYSLTCEQLQQK 288
            ...|           ..|:.|:      |.:..:..|::|:|
  Rat   251 YLTM-----------CAPLGPNYMSEVVCLQRPVGTERIQEK 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4483NP_648294.1 zf-DHHC 88..224 CDD:279823 41/145 (28%)
Zdhhc19NP_001034348.1 zf-DHHC 112..230 CDD:279823 40/141 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.