DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4483 and ZDHHC22

DIOPT Version :9

Sequence 1:NP_648294.1 Gene:CG4483 / 39057 FlyBaseID:FBgn0035970 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_001351101.1 Gene:ZDHHC22 / 283576 HGNCID:20106 Length:263 Species:Homo sapiens


Alignment Length:251 Identity:59/251 - (23%)
Similarity:93/251 - (37%) Gaps:78/251 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 LYNFIRSLMVGPGFVPLKWHPQLTKDKMFLQFCTR------------------CNGYKA------ 102
            |:.|:.|:...|....| :.|.|....:||.....                  |.|..|      
Human    27 LFLFLPSMREDPAAARL-FSPALLHGALFLFLSANALGNYVLVIQNSPDDLGACQGASARKTPCP 90

  Fly   103 -PRSHHCRRCNRCVMKMDHHCPWINTCVGWSNQDSFVYFLLFFMSGSIH---GGIIIVSAVIRGI 163
             |.:|.||.|.|..::.||||.:...|:|..|..:||.|.|:.....::   .|:..:|||    
Human    91 SPSTHFCRVCARVTLRHDHHCFFTGNCIGSRNMRNFVLFCLYTSLACLYSMVAGVAYISAV---- 151

  Fly   164 KKRWLIRYGLRH-MATVHLTQTNLLACVFSLGVIMGTVLASIKLLYM--------------QMKS 213
                 :.....| :|.:.|..|::  ..|..|.::|:.:..|.:||:              |:..
Human   152 -----LSISFAHPLAFLTLLPTSI--SQFFSGAVLGSEMFVILMLYLWFAIGLACAGFCCHQLLL 209

  Fly   214 ILKNQTEIENWIVKKAAFRRNAYPRKGIKPFVYPYNLGWKTNMREVFFSTGDGISW 269
            ||:.||..:              .|||:.....|    |:.|::|||     |..|
Human   210 ILRGQTRHQ--------------VRKGVAVRARP----WRKNLQEVF-----GKRW 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4483NP_648294.1 zf-DHHC 88..224 CDD:279823 41/178 (23%)
ZDHHC22NP_001351101.1 DHHC 92..218 CDD:366691 36/136 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.