DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4483 and ZDHHC24

DIOPT Version :9

Sequence 1:NP_648294.1 Gene:CG4483 / 39057 FlyBaseID:FBgn0035970 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_997223.1 Gene:ZDHHC24 / 254359 HGNCID:27387 Length:284 Species:Homo sapiens


Alignment Length:307 Identity:72/307 - (23%)
Similarity:112/307 - (36%) Gaps:104/307 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 WAPGSS------LESVLNYALIWIQTFGTLYNFIRSLMVGPGFVPL--------------KWHPQ 83
            ||.||:      |..||  ..:|....|....::  |::|||..||              :....
Human     5 WAAGSTDGAPAQLPLVL--TALWAAAVGLELAYV--LVLGPGPPPLGPLARALQLALAAFQLLNL 65

  Fly    84 LTKDKMFLQ--------------------FCTRCNGYKAPRSHHCRRCNRCVMKMDHHCPWINTC 128
            |....:||:                    :|.:|.....|||.||..|..|:::.||||..:..|
Human    66 LGNVGLFLRSDPSIRGVMLAGRGLGQGWAYCYQCQSQVPPRSGHCSACRVCILRRDHHCRLLGRC 130

  Fly   129 VGWSNQDSFVYFLLFFMSGSIHGGIII---VSAVIRG---------IKKRWLI----RYGLRHMA 177
            ||:.|...|:..||......:|..:::   :||::|.         :...||:    |..|...|
Human   131 VGFGNYRPFLCLLLHAAGVLLHVSVLLGPALSALLRAHTPLHMAALLLLPWLMLLTGRVSLAQFA 195

  Fly   178 TVHLTQTNLLACVFSLGVIMGTVLASIKLLYMQMKSILKNQTEIENWIVKKAAFRRNAYPRKGIK 242
            ...:|.|    ||      .|.:|....||:..| .:|:.||..| |             .:|  
Human   196 LAFVTDT----CV------AGALLCGAGLLFHGM-LLLRGQTTWE-W-------------ARG-- 233

  Fly   243 PFVYPYNLGWKTNMREV------------FFST---GDGISWPVLPD 274
              .:.|:||...|::..            |.::   ||||::....|
Human   234 --QHSYDLGPCHNLQAALGPRWALVWLWPFLASPLPGDGITFQTTAD 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4483NP_648294.1 zf-DHHC 88..224 CDD:279823 44/171 (26%)
ZDHHC24NP_997223.1 zf-DHHC 95..234 CDD:279823 44/167 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.