DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4483 and ZDHHC20

DIOPT Version :9

Sequence 1:NP_648294.1 Gene:CG4483 / 39057 FlyBaseID:FBgn0035970 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_001316988.1 Gene:ZDHHC20 / 253832 HGNCID:20749 Length:365 Species:Homo sapiens


Alignment Length:336 Identity:78/336 - (23%)
Similarity:135/336 - (40%) Gaps:99/336 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 RRFIHWGPITLLTLTLIVTWT-----------VIHMNSMWWAPGSSLESVLNYALIWIQTFGTLY 63
            :|.:.|.|:  |.:|.:|.|:           .|..|.   ..|.::..::.:.|.::.   .::
Human    11 QRVVGWVPV--LFITFVVVWSYYAYVVELCVFTIFGNE---ENGKTVVYLVAFHLFFVM---FVW 67

  Fly    64 NFIRSLMVGPGFVPLK-----------WHPQLTKDKM--------------------FLQFCTRC 97
            ::..::...|. .|.|           :..:.::::.                    .:::|.:|
Human    68 SYWMTIFTSPA-SPSKEFYLSNSEKERYEKEFSQERQQEILRRAARALPIYTTSASKTIRYCEKC 131

  Fly    98 NGYKAPRSHHCRRCNRCVMKMDHHCPWINTCVGWSNQDSFVYFLLFFMSGSIHGGIIIVSAVIRG 162
            ...|..|:|||..|:.|::||||||||:|.|||:||...|:.|||:    |:...:.:.:.|:..
Human   132 QLIKPDRAHHCSACDSCILKMDHHCPWVNNCVGFSNYKFFLLFLLY----SLLYCLFVAATVLEY 192

  Fly   163 IKKRWLIRYGLRHMATVHLTQTNLLACVFSLGVIMGTVLASIKLLYMQMKSIL-KNQTEIENWIV 226
            ..|.|          |..||.|.....|..|..:......|:..|:.....:: ||:|.||    
Human   193 FIKFW----------TNELTDTRAKFHVLFLFFVSAMFFISVLSLFSYHCWLVGKNRTTIE---- 243

  Fly   227 KKAAFRRNAYPRKGIKPFVYPYNLGWKTNMREVF-----------FST-GDGISWPV-------- 271
               :||.   |.....|....::||...|.|:||           ||: |||.|:|.        
Human   244 ---SFRA---PTFSYGPDGNGFSLGCSKNWRQVFGDEKKYWLLPIFSSLGDGCSFPTRLVGMDPE 302

  Fly   272 ---LPDCNEYS 279
               :.:.|||:
Human   303 QASVTNQNEYA 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4483NP_648294.1 zf-DHHC 88..224 CDD:279823 44/156 (28%)
ZDHHC20NP_001316988.1 zf-DHHC 16..301 CDD:327686 74/317 (23%)
Substrate binding. /evidence=ECO:0000305|PubMed:29326245 140..143 2/2 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1491968at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.