DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4483 and Zdhhc19

DIOPT Version :9

Sequence 1:NP_648294.1 Gene:CG4483 / 39057 FlyBaseID:FBgn0035970 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_955013.1 Gene:Zdhhc19 / 245308 MGIID:2682948 Length:347 Species:Mus musculus


Alignment Length:320 Identity:74/320 - (23%)
Similarity:128/320 - (40%) Gaps:78/320 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 IHWGPITL-----LTLTLIVT---------WTVIHMNSMWWAPGSSLESVLNYALIWIQTFGTLY 63
            :.|.|.::     :||.|.::         |.|  .|..|..|..:       ..::|.||.:|.
Mouse    22 LSWFPSSVFAAFNVTLLLFLSGLFFGFPCRWLV--QNGEWAFPAIT-------GPLFILTFFSLV 77

  Fly    64 NFIRSLMVGPGFV--------PLKWHPQLTKDKMF-LQFCTRCNGYKAPRSHHCRRCNRCVMKMD 119
            :...|   .||.:        |:..|......:.| |::|.:|..::.||::||..||.||...|
Mouse    78 SLNFS---DPGILHRGSTKEDPMTVHVVRVNQRAFRLEWCPKCLFHRPPRTYHCPWCNICVEDFD 139

  Fly   120 HHCPWINTCVGWSNQDSFVYFLLFFMSGSIHGGIIIVSAVIRGIKKRWLIRYGLRHMATVHLTQT 184
            |||.|:|.|:|..|   |..|:|..:|..::.|.::|:.:      .:|.|  .||:........
Mouse   140 HHCKWVNNCIGHRN---FRLFMLLVLSLCLYSGALLVTCL------TFLFR--TRHLPFSLDKGM 193

  Fly   185 NLLACVFSLGVIMGTVLASIKLLYMQMKSILKNQTEIENWIVKKAAFRRNAYPRKGIKPFVYPYN 249
            .:|..|.:.|.::...|    ||.:|..|:.:.::..|:    |..:.          |...|::
Mouse   194 AILVAVPAAGFLIPLFL----LLLIQALSVSRAESSYES----KCRYH----------PEYNPFD 240

  Fly   250 LGWKTNMREVFFSTGDGISWPVLPD------CNEYSLTCEQLQQKKDKRARTRVFRCIRP 303
            .|:..|.....|:       |:.|:      |.:..:....:|:|.......|...| ||
Mouse   241 QGFAKNWYLAMFA-------PLGPNYMSEVVCLQRPVGTAWIQEKTKPSPPRRPKHC-RP 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4483NP_648294.1 zf-DHHC 88..224 CDD:279823 40/136 (29%)
Zdhhc19NP_955013.1 DHHC 109..>181 CDD:366691 28/80 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 275..347 6/19 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.