DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4483 and Zdhhc5

DIOPT Version :9

Sequence 1:NP_648294.1 Gene:CG4483 / 39057 FlyBaseID:FBgn0035970 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_659136.1 Gene:Zdhhc5 / 228136 MGIID:1923573 Length:715 Species:Mus musculus


Alignment Length:267 Identity:65/267 - (24%)
Similarity:103/267 - (38%) Gaps:55/267 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 PITLLTLTLIVTWTVIHMNSMWWAPGSSLE---SVLNYALIWIQTFGTLYNFIRSLMVGPGFVPL 78
            |::...:.|:...|:..   .:..||.||.   :|..|..|..  ...|.||..:..:.||..|.
Mouse    16 PVSAAAIFLVGATTLFF---AFTCPGLSLNVSPAVPIYNAIMF--LFVLANFSMATFMDPGIFPR 75

  Fly    79 KWHPQLTKD---------------KMFLQFCTRCNGYKAPRSHHCRRCNRCVMKMDHHCPWINTC 128
            ....:..:|               ::.:::|..|..|:.||..||..|:.||.:.||||||:|.|
Mouse    76 AEEDEDKEDDFRAPLYKTVEIKGIQVRMKWCATCRFYRPPRCSHCSVCDNCVEEFDHHCPWVNNC 140

  Fly   129 VGWSNQDSFVYFLLFFMSGSIHGGIIIVSAVIRGIKKRWL--IRYGLRHMATVHLTQTNLLACVF 191
            :|..|   :.||.||.:|.:.|         |.|:....|  :.|.:..::.|....|..:.||.
Mouse   141 IGRRN---YRYFFLFLLSLTAH---------IMGVFGFGLLYVLYHIEELSGVRTAVTMAVMCVA 193

  Fly   192 SLGVIMGTVLASIKLLYMQMKSILKNQTEIENWIVKKAAFRRNAYPRKGIKPFVYPYNLGWKTNM 256
            .|..|....|....::.     :.:.:|..|....|.         |.|:.||..    |...|:
Mouse   194 GLFFIPVAGLTGFHVVL-----VARGRTTNEQVTGKF---------RGGVNPFTN----GCCNNV 240

  Fly   257 REVFFST 263
            ..|..|:
Mouse   241 SRVLCSS 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4483NP_648294.1 zf-DHHC 88..224 CDD:279823 39/137 (28%)
Zdhhc5NP_659136.1 zf-DHHC 99..224 CDD:279823 39/141 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 289..715
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.