DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4483 and dhhc-5

DIOPT Version :9

Sequence 1:NP_648294.1 Gene:CG4483 / 39057 FlyBaseID:FBgn0035970 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_498488.2 Gene:dhhc-5 / 187870 WormBaseID:WBGene00020066 Length:244 Species:Caenorhabditis elegans


Alignment Length:265 Identity:70/265 - (26%)
Similarity:113/265 - (42%) Gaps:74/265 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 WIQTFGTLY--------------NFIRSLMV----GPGFVPLKWHPQLTKDKMFLQFCTR----- 96
            |.|....||              :|:..::|    ...|.|    |...:|...::.|.:     
 Worm    22 WYQIIVVLYAADGTISQWALYYFHFLWIIIVCSYFSASFTP----PTKCRDVEKVEHCDKEIKED 82

  Fly    97 ----CNGYKAPRSHHCRRCNRCVMKMDHHCPWINTCVGWSNQDSFVYFLLFFMSGSIHGGIIIVS 157
                ||..|.||.|||||||.||.:||||||.:..|:...|...|:.||::.:.       :.:.
 Worm    83 VCQLCNYRKPPRWHHCRRCNLCVHRMDHHCPILQLCIHSGNHKYFLLFLVWPLQ-------LAIF 140

  Fly   158 AVIRGIKKRWLIRYGLRHMATVHLTQTN--LLACVFSLGVIMGTVLASIKLLYMQMKSILKNQTE 220
            .:..|....|..   :|.:.|..:..|:  |.....|..:::|  :|::.||..|:.::::|||.
 Worm   141 TIWHGYYDFWKT---IRSVYTAEILSTSEQLKGTGVSNALMVG--IAALYLLKNQLPNLMRNQTL 200

  Fly   221 IENWIVKKAAFRRNAYPRKGIKPFVYPYNLG-WKTNMREVFFSTGDGISWPVLPDCNEYSLTCEQ 284
            ||.       .|.|.           .|||| |:.|::.|..:.  .|:|  ||    :|:|  :
 Worm   201 IEE-------SRENT-----------SYNLGSWQENVKSVMGAW--TIAW--LP----FSVT--K 237

  Fly   285 LQQKK 289
            .::||
 Worm   238 SREKK 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4483NP_648294.1 zf-DHHC 88..224 CDD:279823 43/146 (29%)
dhhc-5NP_498488.2 zf-DHHC 77..202 CDD:279823 40/136 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1491968at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.780

Return to query results.
Submit another query.