DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4483 and dhhc-2

DIOPT Version :9

Sequence 1:NP_648294.1 Gene:CG4483 / 39057 FlyBaseID:FBgn0035970 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_493007.2 Gene:dhhc-2 / 173062 WormBaseID:WBGene00012948 Length:404 Species:Caenorhabditis elegans


Alignment Length:215 Identity:49/215 - (22%)
Similarity:80/215 - (37%) Gaps:66/215 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 GPITLLTLTLIVTWTVIHMNS---MW-WAPGSSL-ESVLNYALIWIQTFGTLYNFIRSLMVGPGF 75
            |...:..:.:|.|.||..:..   :| ::|...: .:||:..:|        .||..:....||.
 Worm    99 GAFVVTVILMIATLTVYFVFDAPFLWGYSPAIPIVAAVLSLIVI--------TNFFATSFTDPGI 155

  Fly    76 VPLKWHPQLTK----------------------------DKMFLQFCTRCNGYKAPRSHHCRRCN 112
            :|...:.::.:                            :.:.:::||.|..|:.||..||..|:
 Worm   156 LPRVDNIEIIEMDRQQANGNGINDVAHLRPRFQDVVVNGEHVKMKYCTTCRLYRPPRCSHCAICD 220

  Fly   113 RCVMKMDHHCPWINTCVGWSNQDSFVYFLLFFMSGSIHGGIIIVSAVIRGIKKRWLIRYGLRHMA 177
            .||:..||||||:..|:|..|   :.||..|....||....:..|||                  
 Worm   221 NCVLMFDHHCPWVGNCIGLRN---YTYFYRFVFCLSILVIYLFASAV------------------ 264

  Fly   178 TVHLTQTNLLACVFSLGVIM 197
                |..:|||.....|.:|
 Worm   265 ----THISLLAQEMPFGDVM 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4483NP_648294.1 zf-DHHC 88..224 CDD:279823 34/110 (31%)
dhhc-2NP_493007.2 zf-DHHC 72..>319 CDD:303066 49/215 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.