DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4483 and Zdhhc15

DIOPT Version :9

Sequence 1:NP_648294.1 Gene:CG4483 / 39057 FlyBaseID:FBgn0035970 Length:435 Species:Drosophila melanogaster
Sequence 2:XP_011245807.1 Gene:Zdhhc15 / 108672 MGIID:1915336 Length:355 Species:Mus musculus


Alignment Length:323 Identity:79/323 - (24%)
Similarity:131/323 - (40%) Gaps:103/323 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 RRFIHWGPITLLTLTLIVTW------------TVIHMNSMWWAPGSSLESVLNYALIWIQTFGTL 62
            ||.:.|.|:  |.:.|:|.|            ||:       :|...:..::.|..|::....|.
Mouse    17 RRVLSWVPV--LVIVLVVLWSYYAYVFELCLVTVL-------SPAEKVIYLILYHAIFVFFAWTY 72

  Fly    63 YNFIRSLMVGPGFVPLKWH--------------PQLTKDKMF----------------LQFCTRC 97
            :..|.:|...|.   .|:|              |::.|..:.                ::||.||
Mouse    73 WKSIFTLPQQPN---QKFHLSYTDKERYKNEERPEVQKQMLVDMAKKLPVYTRTGSGAVRFCDRC 134

  Fly    98 NGYKAPRSHHCRRCNRCVMKMDHHCPWINTCVGWSNQDSFVYFLLFFMSGSIHGGIIIVSAVIRG 162
            :..|..|.|||..|..||:||||||||:|.|:|:||...|:.||.:    |:...:.|.:.|.  
Mouse   135 HLIKPDRCHHCSVCAMCVLKMDHHCPWVNNCIGFSNYKFFLQFLAY----SVLYCLYIATTVF-- 193

  Fly   163 IKKRWLIRYGLRHMATV----HLTQTNLLACVFSLGVIMGTVLASIKLLYMQMKSILKNQTEIEN 223
               .:.|:|....:.:|    |:.....:||:|.:.:::        |.......:.:|:|.:| 
Mouse   194 ---SYFIKYWRGELPSVRSKFHVLFLLFVACMFFVSLVI--------LFGYHCWLVSRNKTTLE- 246

  Fly   224 WIVKKAAFRRNAY---PRKGIKPFVYPYNLGWKTNMREVF------------FSTGDGISWPV 271
                  ||....:   |.|.      .:|||:..|:::||            .|.|||.|:|:
Mouse   247 ------AFCTPVFTSGPEKN------GFNLGFIKNIQQVFGDNKKFWLIPIGSSPGDGHSFPM 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4483NP_648294.1 zf-DHHC 88..224 CDD:279823 42/155 (27%)
Zdhhc15XP_011245807.1 DHHC <126..308 CDD:388695 58/202 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1491968at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.