DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4483 and zdhhc22

DIOPT Version :9

Sequence 1:NP_648294.1 Gene:CG4483 / 39057 FlyBaseID:FBgn0035970 Length:435 Species:Drosophila melanogaster
Sequence 2:XP_001340992.2 Gene:zdhhc22 / 100000886 ZFINID:ZDB-GENE-131127-476 Length:280 Species:Danio rerio


Alignment Length:276 Identity:54/276 - (19%)
Similarity:104/276 - (37%) Gaps:71/276 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 ITLLTLTLIVTWTVIHMNSMWWAPGSSLESVLNYALIWIQTFG-TLYNFIRSLMVGPGFVPLKWH 81
            :|.....|:.|.|:...:.:...|     ::|.:..|::...| .|.|:|.::.          :
Zfish    25 VTFALHFLLFTPTIFQSSDVTINP-----AMLAHISIFLFLMGNALGNYIMTIR----------N 74

  Fly    82 PQLTKDKMFLQFCT-----RCNG-YKAPRSHHCRRCNRCVMKMDHHCPWINTCVGWSNQDSFVYF 140
            |..:.::..:..|:     |.:. |.....|.|:.|.:.::|.||||.:...|:|..|...|:.|
Zfish    75 PSESANETVIPVCSPDCPDRIDAHYLLNGRHFCKVCKKVILKRDHHCFFTGNCIGNRNMRYFIMF 139

  Fly   141 LLFFMSGSIHGGIIIVSAVIRGIKKRWLIRYGLR-HMATVHLTQTNLLACVFSLGVIMGTVLASI 204
            .::..|..::..:|.|:.:        .|.|.:. ......||...|....|.||:|.|.....:
Zfish   140 SIYTSSSCLYSLVIGVAYL--------TIEYSISFENPLTFLTLLPLSTGYFFLGLISGLQFFLV 196

  Fly   205 KLLYM--------------QMKSILKNQT--EIENWIVKKAAFRRNAYPRKGIKPFVYPYNLGWK 253
            .:||:              |:..:.:.||  |::...:.:.         :|.          |:
Zfish   197 IMLYIWLGIGLVSVGFCCQQLLLVARGQTWCELQKGQLSEC---------RGT----------WR 242

  Fly   254 TNMREVFFSTGDGISW 269
            .|:.:||     |..|
Zfish   243 ANLTDVF-----GSHW 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4483NP_648294.1 zf-DHHC 88..224 CDD:279823 35/158 (22%)
zdhhc22XP_001340992.2 zf-DHHC 105..233 CDD:307600 32/135 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.