DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Slc45-1 and Scrt2

DIOPT Version :9

Sequence 1:NP_001261618.1 Gene:Slc45-1 / 39055 FlyBaseID:FBgn0035968 Length:599 Species:Drosophila melanogaster
Sequence 2:NP_001178834.1 Gene:Scrt2 / 366229 RGDID:1564796 Length:305 Species:Rattus norvegicus


Alignment Length:55 Identity:11/55 - (20%)
Similarity:20/55 - (36%) Gaps:19/55 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   402 GHVTYCLYFTDFVGE------------------AVFHGDPTAAPNSEAALNYEAG 438
            |:|.:|:..:.:.||                  :..:.|| .:|.|..:..|..|
  Rat    45 GYVAHCMPPSGYDGEQKPGLELAPTEPAYPAAASEEYSDP-ESPQSSLSARYFRG 98

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Slc45-1NP_001261618.1 GPH_sucrose 49..568 CDD:273545 11/55 (20%)
MFS 444..>597 CDD:119392
Scrt2NP_001178834.1 C2H2 Zn finger 157..177 CDD:275368
COG5048 <210..>277 CDD:227381
zf-C2H2 212..234 CDD:278523
C2H2 Zn finger 214..234 CDD:275368
zf-H2C2_2 227..250 CDD:290200
C2H2 Zn finger 242..262 CDD:275368
zf-C2H2 242..262 CDD:278523
zf-H2C2_2 254..278 CDD:290200
C2H2 Zn finger 270..286 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.