DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Slc45-1 and scrt2

DIOPT Version :9

Sequence 1:NP_001261618.1 Gene:Slc45-1 / 39055 FlyBaseID:FBgn0035968 Length:599 Species:Drosophila melanogaster
Sequence 2:NP_998802.1 Gene:scrt2 / 325372 ZFINID:ZDB-GENE-030131-4097 Length:312 Species:Danio rerio


Alignment Length:140 Identity:24/140 - (17%)
Similarity:42/140 - (30%) Gaps:41/140 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   149 DAGYTYAESALNFTSSSGGSVAALVSGEATTGPSASDYKFAVILTILGMVLLDFDADTCQTPART 213
            |..::.:.|:|.......|.:...:|....|....:|.|              .:::...:|..:
Zfish    34 DDSFSRSRSSLGVRLCENGYIKDYISSSEYTEEKQADMK--------------LNSELLYSPVSS 84

  Fly   214 YLLDMCVPE-EQP---------------------KAMTMFALFAGFG-----GTIGYAIGGVDWE 251
            ...:.|.|: |.|                     :..||.|.|...|     |.:..|....:.|
Zfish    85 GGGEYCQPDLEHPDSPQSGLTARGYFSSESESLSEGYTMDAFFISDGRSRRKGEVSEAAKADEVE 149

  Fly   252 TTHIGSFMGG 261
            ...:|...||
Zfish   150 KEVVGVNNGG 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Slc45-1NP_001261618.1 GPH_sucrose 49..568 CDD:273545 24/140 (17%)
MFS 444..>597 CDD:119392
scrt2NP_998802.1 zf-C2H2 162..184 CDD:278523
C2H2 Zn finger 164..184 CDD:275368
C2H2 Zn finger 195..212 CDD:275371
COG5048 219..>295 CDD:227381
zf-C2H2 219..241 CDD:278523
C2H2 Zn finger 221..241 CDD:275368
zf-H2C2_2 234..257 CDD:290200
zf-C2H2 247..269 CDD:278523
C2H2 Zn finger 249..269 CDD:275368
C2H2 Zn finger 277..293 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.