powered by:
Protein Alignment Slc45-1 and Scrt1
DIOPT Version :9
Sequence 1: | NP_001261618.1 |
Gene: | Slc45-1 / 39055 |
FlyBaseID: | FBgn0035968 |
Length: | 599 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_570963.1 |
Gene: | Scrt1 / 170729 |
MGIID: | 2176606 |
Length: | 348 |
Species: | Mus musculus |
Alignment Length: | 61 |
Identity: | 24/61 - (39%) |
Similarity: | 28/61 - (45%) |
Gaps: | 17/61 - (27%) |
- Green bases have known domain annotations that are detailed below.
Fly 139 YGK---DLGLLLGDAGY---------TY---AESALNFTSSSGGSVAALVSGEATTGPSAS 184
||: |||:.|.|.|| .| ||:||....|.....||.|.|| .||:||
Mouse 24 YGRARSDLGVRLQDKGYLSDYVGPASVYDGDAEAALLKGPSPEPMYAAAVRGE--LGPAAS 82
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
0 | 0.000 |
|
Return to query results.
Submit another query.