DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Slc45-1 and Scrt1

DIOPT Version :9

Sequence 1:	NP_001261618.1	Gene:	Slc45-1 / 39055	FlyBaseID:	FBgn0035968	Length:	599	Species:	Drosophila melanogaster
Sequence 2:	NP_570963.1	Gene:	Scrt1 / 170729	MGIID:	2176606	Length:	348	Species:	Mus musculus

Alignment Length:	61	Identity:	24/61 - (39%)
Similarity:	28/61 - (45%)	Gaps:	17/61 - (27%)

- Green bases have known domain annotations that are detailed below.

  Fly   139 YGK---DLGLLLGDAGY---------TY---AESALNFTSSSGGSVAALVSGEATTGPSAS 184
            ||:   |||:.|.|.||         .|   ||:||....|.....||.|.||  .||:||
Mouse    24 YGRARSDLGVRLQDKGYLSDYVGPASVYDGDAEAALLKGPSPEPMYAAAVRGE--LGPAAS 82

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Slc45-1	NP_001261618.1	GPH_sucrose	49..568	CDD:273545	24/61 (39%)
Slc45-1	NP_001261618.1	MFS	444..>597	CDD:119392
Scrt1	NP_570963.1	SNAG domain. /evidence=ECO:0000250	1..20
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	130..190
		zf-C2H2	191..213	CDD:278523
		C2H2 Zn finger	193..213	CDD:275368
		C2H2 Zn finger	224..241	CDD:275371
		COG5048	<245..>313	CDD:227381
		zf-C2H2	248..270	CDD:278523
		C2H2 Zn finger	250..270	CDD:275368
		zf-H2C2_2	263..286	CDD:290200
		C2H2 Zn finger	278..298	CDD:275368
		zf-C2H2	278..298	CDD:278523
		zf-H2C2_2	290..314	CDD:290200
		C2H2 Zn finger	306..322	CDD:275368
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	0	0.000