DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Slc45-1 and scrt2

DIOPT Version :9

Sequence 1:NP_001261618.1 Gene:Slc45-1 / 39055 FlyBaseID:FBgn0035968 Length:599 Species:Drosophila melanogaster
Sequence 2:XP_031760336.1 Gene:scrt2 / 100486069 XenbaseID:XB-GENE-5995512 Length:278 Species:Xenopus tropicalis


Alignment Length:132 Identity:23/132 - (17%)
Similarity:39/132 - (29%) Gaps:62/132 - (46%)


- Green bases have known domain annotations that are detailed below.


  Fly   385 MPYSMRMLALTNLFC--------------WMGHVTYCLYFTDFVGEAVFHGD------------- 422
            ||.|..:..:.:.||              :..|::...|.::::..:|:.||             
 Frog     1 MPRSFLVKKVKDGFCSADSESVYGRHRTDFSTHLSDKGYLSEYIAPSVYDGDSDGAIKVPSPDAL 65

  Fly   423 --------------PTAAPNSEAA---LNYEAGVRFG------------------CWGMAIYAFS 452
                          |..:|.||..   :|.:|.|..|                  ..|.:|...|
 Frog    66 YTTVHSEYGAADSEPPDSPRSEITGGYINGDAAVSEGYSVDAFFITDGRSRRKVLSGGRSIQRHS 130

  Fly   453 CS 454
            ||
 Frog   131 CS 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Slc45-1NP_001261618.1 GPH_sucrose 49..568 CDD:273545 23/132 (17%)
MFS 444..>597 CDD:119392 5/11 (45%)
scrt2XP_031760336.1 C2H2 Zn finger 131..151 CDD:275368 2/2 (100%)
C2H2 Zn finger 162..179 CDD:275371
COG5048 186..>262 CDD:227381
C2H2 Zn finger 188..208 CDD:275368
C2H2 Zn finger 216..236 CDD:275368
C2H2 Zn finger 244..260 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.