DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rdl and gabrb2b

DIOPT Version :9

Sequence 1:NP_001261617.1 Gene:Rdl / 39054 FlyBaseID:FBgn0004244 Length:608 Species:Drosophila melanogaster
Sequence 2:XP_005174507.3 Gene:gabrb2b / 100332196 ZFINID:ZDB-GENE-111215-5 Length:191 Species:Danio rerio


Alignment Length:124 Identity:51/124 - (41%)
Similarity:78/124 - (62%) Gaps:5/124 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 NISAI---LDSFSVSYDKRVRPNYGGPPVEVGVTMYVLSISSLSEVKMDFTLDFYFRQFWTDPRL 119
            |:|.:   :|.....||.|:||::|||||.||:.:.:.||..:|||.||:||..||:|.|.|.||
Zfish    70 NMSLVKETVDRLLKGYDIRLRPDFGGPPVGVGMNIDIASIDMVSEVNMDYTLTMYFQQAWRDKRL 134

  Fly   120 AYRKRPGVETLSVGSEFIKNIWVPDTFFVNEKQSYFHIATTSNEFIRVHHSGSITRSIR 178
            :|.:.|  ..|::.:.....:|||||:|:|:|:|:.|..|..|..||:|..|::...:|
Zfish   135 SYSEIP--LNLTLDNRVADQLWVPDTYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLR 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RdlNP_001261617.1 LGIC_ECD_GABAR_RDL-like 83..266 CDD:349809 39/96 (41%)
Neur_chan_memb 274..588 CDD:397193
gabrb2bXP_005174507.3 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D226476at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.