DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nwk and AT4G18060

DIOPT Version :9

Sequence 1:NP_001286994.1 Gene:nwk / 39052 FlyBaseID:FBgn0263456 Length:1075 Species:Drosophila melanogaster
Sequence 2:NP_193540.3 Gene:AT4G18060 / 827531 AraportID:AT4G18060 Length:351 Species:Arabidopsis thaliana


Alignment Length:478 Identity:94/478 - (19%)
Similarity:154/478 - (32%) Gaps:171/478 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   269 ATQNSFGKIRDQA--QQLTREYNLQCCYLFYPVLKQHIQYDFEACDNDPVRKVTAEHESAAETL- 330
            |.:....|:|||.  |||.             |:||.....:|:.|...:.::..:.....:.| 
plant     3 AFRRQASKLRDQVAKQQLA-------------VIKQFSGTGYESSDVMVIDELEMQRHHQLDKLY 54

  Fly   331 --TKEAKNLAGRVVKENASIR-------ENAKKLA--LCQSLRDSGQRTDPN----------DPN 374
              |:.||.....:||...:..       |...||:  .|:...::.|..|.|          |..
plant    55 RSTRSAKEFQRDIVKAAEAFTTIGLRHIEAGTKLSEDCCRYGNENSQNIDENILAKAAAIYGDAR 119

  Fly   375 GPDLDTKIEEFRDQIRRSETEKTKAEACLQCLRDGGINVDEWVQEAENMGVQELTRSASSISMRT 439
             ..:|.:.|:|         .|..|...|..||  .:.....:::|.:: .|..:|      ||.
plant   120 -KHVDKEQEDF---------NKLLASQVLDPLR--AMVAGSPLEDARHL-AQRYSR------MRQ 165

  Fly   440 DASGQGENPSSDSFYDSDKEETQAAAQTKPKQEQQLSRDRTFSDSEDEPEVRPSAAAASSAAAAS 504
            :|                  ||.|   |:..:.|...|         |..:..:.|....|.|..
plant   166 EA------------------ETHA---TEVSRRQARVR---------EAPIPENVAKLQLAEAKM 200

  Fly   505 SSMMASSA--GGWDDPTEVNWGAGEEEDDKDEPIVPEPKEAIFKCTALYSYTAQNPDELTIVENE 567
            ..:.|:.|  |                           |||    ||..:........||.   :
plant   201 QELKANMAVLG---------------------------KEA----TAALAAVESQQHRLTF---Q 231

  Fly   568 QLEVVGEGDGDGWLRARNYRGEEGYVPHNYLDIDQETAGSAFNGTSGNQLRSQISFSSVDYTVDN 632
            :|..:.||:       :||                             .||.....|.::..:..
plant   232 RLVAMVEGE-------KNY-----------------------------HLRIAAILSDIEAEMVT 260

  Fly   633 EDQTVDSMQSPDQVSVIMAPQKRVKSDVEWCIA--LYDYDATAEDELTFEEGDKIKIITKTAHGV 695
            |.|..:|  :|..:     |.:.......:.:|  ::.:.|.:|.||..::||.| ::.|.:   
plant   261 EKQHKES--APPAI-----PTENGSEKTSYFLAEVIHPFSAASEKELDLDKGDYI-VVRKVS--- 314

  Fly   696 DDGWWEGELDGKFGNFPSLVVEE 718
            ..||.|||..||.|.||...:|:
plant   315 QTGWAEGECKGKAGWFPMAYIEK 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nwkNP_001286994.1 BAR 16..281 CDD:353336 4/11 (36%)
SH3_FCHSD_1 545..600 CDD:212695 9/54 (17%)
SH3 663..718 CDD:354299 19/56 (34%)
PRK12323 <725..956 CDD:237057
AT4G18060NP_193540.3 BAR 49..257 CDD:416402 56/326 (17%)
SH3 285..337 CDD:418401 19/55 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.