DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nwk and SRGAP2B

DIOPT Version :9

Sequence 1:NP_001286994.1 Gene:nwk / 39052 FlyBaseID:FBgn0263456 Length:1075 Species:Drosophila melanogaster
Sequence 2:NP_001372155.1 Gene:SRGAP2B / 647135 HGNCID:35237 Length:489 Species:Homo sapiens


Alignment Length:550 Identity:106/550 - (19%)
Similarity:196/550 - (35%) Gaps:186/550 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 VKFLKNLHTEQVAKLQLKNQHECDLLEDIRQFTIKRSAVEKSYSESLLKISSQYLNKKIPNIPDI 75
            ||.::...|||:..|..:.:....||:|::.|..|::.:|..||.:|.|::.::|.|....    
Human    21 VKEIRAQLTEQMKCLDQQCELRVQLLQDLQDFFRKKAEIEMDYSRNLEKLAERFLAKTCST---- 81

  Fly    76 KMEGMEERWNMWSV-------------------------------------WRTVLEENEKLARA 103
                .::::|.::|                                     |..:|.:.::.:|.
Human    82 ----KDQQFNAFTVIMSPADVQAACDFPGLLSTPESFPLRKDQNVLSPVNCWNLLLNQVKRESRD 142

  Fly   104 RLAAIEVF-------------------------QQQIADE-AKVLRDYKLAIAKRSLAGIVNVQK 142
            .....:::                         .||:.|: .|||.:            :.:|.|
Human   143 HTTLSDIYLNNIIPRFVQVSEDSGRLFKKSKEVGQQLQDDLMKVLNE------------LYSVMK 195

  Fly   143 ELHL----SVGDVDKTKKSYFDEE-HCAHDVRDKARD------------IEEKLKKKKGSFFQSI 190
            ..|:    |:....|.|::...|| .....|:.:.|.            ||||..::  |..:.|
Human   196 TYHMYNADSISAQSKLKEAEKQEEKQIGKSVKQEDRQTPRSPDSTANVRIEEKHVRR--SSVKKI 258

  Fly   191 TSL-QKNSARVTSRKELLEEKSSGARNDYVLSLAAANAHQNRYFTVDLQTTM------------- 241
            ..: :|..|:.|..|    .|:..|||:|:|:|.|.||...:|:..||...:             
Human   259 EKMKEKRQAKYTENK----LKAIKARNEYLLALEATNASVFKYYIHDLSDLIDQCCDLGYHASLN 319

  Fly   242 TTMENYVFERVAEYLMLMGRTELLTCSATQNSFGKI--RDQAQQLTREYNLQCCYLFYPVLKQHI 304
            ..:..::   .||..:...:.|.|  .|.:|:...:  ....|:|...||    .:|.|.:|   
Human   320 RALRTFL---SAELNLEQSKHEGL--DAIENAVENLDATSDKQRLMEMYN----NVFCPPMK--- 372

  Fly   305 QYDFEACDNDPVRKVTAEHESAAETLTKEAKNLAGRVVKENASIRENAKKLALCQSLRDSGQRTD 369
             ::|:....|...::.|:....:|.|.:                         ||.|:..     
Human   373 -FEFQPHMGDMASQLCAQQPVQSELLQR-------------------------CQQLQSR----- 406

  Fly   370 PNDPNGPDLDT-KIEEFRDQIRRSETEKTKAEACLQCLRD----GGINVDEWVQEAENMGVQELT 429
                    |.| |||       ..|.:|| .||.||.::|    ...:|.:..|.:.:|...:.|
Human   407 --------LSTLKIE-------NEEVKKT-MEATLQTIQDIVTVEDFDVSDCFQYSNSMESVKST 455

  Fly   430 RSASSISMRTDASGQGENPSSDSFYDSDKE 459
            .|.:.:|..:.|..:.....::.||.:.:|
Human   456 VSETFMSKPSIAKRRANQQETEQFYFTVRE 485

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nwkNP_001286994.1 BAR 16..281 CDD:353336 66/360 (18%)
SH3_FCHSD_1 545..600 CDD:212695
SH3 663..718 CDD:354299
PRK12323 <725..956 CDD:237057
SRGAP2BNP_001372155.1 BAR 26..319 CDD:416402 60/318 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3565
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.