DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nwk and mlc-7

DIOPT Version :9

Sequence 1:NP_001286994.1 Gene:nwk / 39052 FlyBaseID:FBgn0263456 Length:1075 Species:Drosophila melanogaster
Sequence 2:NP_001022669.1 Gene:mlc-7 / 176811 WormBaseID:WBGene00023451 Length:153 Species:Caenorhabditis elegans


Alignment Length:131 Identity:28/131 - (21%)
Similarity:46/131 - (35%) Gaps:46/131 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   760 LELTEDMFGSQDTADE---DSGYIPNGAAAPSI-PPPVLIQEPGMEDDLSDDGQPPPSLPPPQLA 820
            ::...|:|...||..:   ||..:|....|..: |...|:.|                     ::
 Worm     7 MDEVHDVFHFHDTLGDGKIDSKQLPTALRAMMLNPTEALLAE---------------------VS 50

  Fly   821 KAGGSAPGSGSKVEK--------GAAAGGANTL-----------NLGMAQIIVTAATPMVEDGAD 866
            ||..|  |:...||:        .||.|.:.||           ..|..||::.....|:::|.:
 Worm    51 KARTS--GARITVEEFIPIYKKVEAACGRSTTLKEFQTLLSHFDREGNGQIMLMELKSMLQNGGE 113

  Fly   867 K 867
            |
 Worm   114 K 114

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nwkNP_001286994.1 BAR 16..281 CDD:353336
SH3_FCHSD_1 545..600 CDD:212695
SH3 663..718 CDD:354299
PRK12323 <725..956 CDD:237057 28/131 (21%)
mlc-7NP_001022669.1 FRQ1 8..139 CDD:227455 28/130 (22%)
EFh 9..65 CDD:298682 17/78 (22%)
EF-hand_8 55..109 CDD:290545 13/55 (24%)
EFh 83..140 CDD:298682 6/32 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3565
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.